1531 lines
		
	
	
		
			55 KiB
		
	
	
	
		
			Plaintext
		
	
	
	
	
	
			
		
		
	
	
			1531 lines
		
	
	
		
			55 KiB
		
	
	
	
		
			Plaintext
		
	
	
	
	
	
version 5.2
 | 
						||
" ==================================================================
 | 
						||
" File:         $HOME/.vimrc
 | 
						||
" Availability: This file is available as
 | 
						||
"               <URL:http://www.math.fu-berlin.de/~guckes/setup/vimrc>
 | 
						||
"               <URL:http://www.math.fu-berlin.de/~guckes/setup/vimrc.gz>
 | 
						||
"               <URL:http://www.vim.org/rc> (mirror)
 | 
						||
" Purpose:      Setup file for the editor Vim (Vi IMproved)
 | 
						||
" Author:       Sven Guckes guckes@vim.org (guckes@math.fu-berlin.de)
 | 
						||
"               <URL:http://www.math.fu-berlin.de/~guckes/sven/>
 | 
						||
" Size:         This file is about 56K in size and has 1,500+ lines.
 | 
						||
" Related files:
 | 
						||
"               http://www.math.fu-berlin.de/~guckes/vim/src/latex.vim
 | 
						||
"               http://www.math.fu-berlin.de/~guckes/vim/src/html.vim
 | 
						||
"               http://www.math.fu-berlin.de/~guckes/vim/syntax/
 | 
						||
" Note:         Please send comments to me - email preferred! :-)
 | 
						||
" Last update:  Fri Aug 28 18:30:00 CEST 1998
 | 
						||
" ===================================================================
 | 
						||
" Latest versions of Vim according to my Vim signature:
 | 
						||
" -- 
 | 
						||
" Sven Guckes guckes@vim.org          | Vim = Vi IMproved |  versions
 | 
						||
" FAQ    http://www.vim.org/faq/      | for  users: VIM-5.2  [980824]
 | 
						||
" Users  http://www.vim.org/user.html | developers: developing...
 | 
						||
" Wishes http://www.vim.org/wish.html | Additions&Corrections welcome!
 | 
						||
" ===================================================================
 | 
						||
" Note to Windows users:  Get these files from any Vim mirror:
 | 
						||
"       vim52rt.zip (840K)
 | 
						||
"       gvimw32.zip (440K)
 | 
						||
" These should fit onto one floppy.  Just a recommendation.
 | 
						||
" ===================================================================
 | 
						||
" Installation of this setup file:
 | 
						||
"
 | 
						||
"  To use this setup file, copy it to
 | 
						||
"  this filename    on these systems:
 | 
						||
"    ~/.vimrc       Unix and OS/2
 | 
						||
"    s:.vimrc       Amiga
 | 
						||
"    $VIM\_vimrc    MS-DOS and Win32
 | 
						||
"
 | 
						||
" NOTE: This setup file uses a lot of features of Vim-5.
 | 
						||
" If you are still using Vim-4 (or an even older version)
 | 
						||
" then you should upgrade - it is really worth the effort!
 | 
						||
" To find out why get Vim-5 and read ":help version5".
 | 
						||
"
 | 
						||
" The first line of this setup file contains the information
 | 
						||
" "version xxx" which allows VIM to check whether the setup file
 | 
						||
" fits the syntax that it understands.
 | 
						||
" Versions of VIM other than of version 5 then will give a warning
 | 
						||
" as they do not understand this setup file command - a feature:
 | 
						||
" Give a warning so the user knows that there is something odd
 | 
						||
" about the setup file.
 | 
						||
" ===================================================================
 | 
						||
" Whitespace meta sequence:
 | 
						||
" vim-5.0s introduced the meta sequence "\s" which stands for "whitespace"
 | 
						||
" ie either a space or a tab.  This makes mappings a lot easier.
 | 
						||
" I have therefore updated my mappings to use this sequence.
 | 
						||
" But this is incompatible with previous versions and, of course, Vi.
 | 
						||
" ===================================================================
 | 
						||
" Info on the latest versions is on the Vim HomePage:
 | 
						||
"       http://www.vim.org/ - which is a daily mirror of the pages at
 | 
						||
"       http://www.math.fu-berlin.de/~guckes/vim/
 | 
						||
" and in Sven's signature file:
 | 
						||
" http://www.math.fu-berlin.de/~guckes/sig/SIGS
 | 
						||
" ===================================================================
 | 
						||
" ===================================================================
 | 
						||
" Structure of this file:
 | 
						||
" Lines starting with an inverted comma (") are comments.
 | 
						||
" Some mappings are commented out.  Remove the comment to enable them.
 | 
						||
"
 | 
						||
" There are three kinds of things which are defined in this file:
 | 
						||
" Mapping ("map"), settings ("set"), and abbreviations ("ab").
 | 
						||
"   Settings affect the behaviour of commands.
 | 
						||
"   Mappings maps a key sequence to a command.
 | 
						||
"   Abbreviations define words which are replaced
 | 
						||
"   right *after* they are typed in.
 | 
						||
"
 | 
						||
" ===================================================================
 | 
						||
" Note on mappings - "angle notation" (see ":help <>"):
 | 
						||
" VIM allows you to define mappings with special characters
 | 
						||
" with a notation that uses non-special characters:
 | 
						||
" The notation encloses decriptive words in angle brackets (<>).
 | 
						||
" The characters you will most often are:
 | 
						||
" <C-M> for control-m
 | 
						||
" <C-V> for control-v which quotes the following character
 | 
						||
" <ESC> for the escape character.
 | 
						||
" All control characters have been replaced to use the angle notation
 | 
						||
" so you should be able to read this file without problems.
 | 
						||
" (Well, sometimes I leave some tabs [control-i] in the file. ;-)
 | 
						||
" ===================================================================
 | 
						||
" External programs:
 | 
						||
" Some mappings make use of external programs.
 | 
						||
" The following you should find on every UNIX system:
 | 
						||
" awk, egrep, grep, ispell, perl, sed.
 | 
						||
" If you are using DOS then you should get these for you system!!
 | 
						||
" Programs that are supplied with the mailer ELM: elmalias, readmsg.
 | 
						||
" To get these look at page
 | 
						||
" http://www.math.fu-berlin.de/~guckes/elm/dist.html
 | 
						||
" One major advantage of vim-5 (actually, 5.0g) is that there is now
 | 
						||
" the internal function "strftime".  This allows to insert the current
 | 
						||
" date and time in various format.  Example:  mapping ",L" (see below)
 | 
						||
" ===================================================================
 | 
						||
" SETtings
 | 
						||
" ===================================================================
 | 
						||
"
 | 
						||
"       autoindent:  "off" as I usually do not write code.
 | 
						||
  set noautoindent
 | 
						||
"
 | 
						||
"       autowrite: "on" saves a lot of trouble
 | 
						||
  set   autowrite
 | 
						||
"
 | 
						||
"       backup:  backups are for wimps  ;-)
 | 
						||
  set nobackup
 | 
						||
"
 | 
						||
"       backspace:  '2' is much smarter.
 | 
						||
  set   backspace=2
 | 
						||
"
 | 
						||
"       background:  Are we using a "light" or "dark" background?
 | 
						||
" set   background=dark
 | 
						||
"
 | 
						||
"       compatible  ....
 | 
						||
  set nocompatible
 | 
						||
"
 | 
						||
"       comments default: sr:/*,mb:*,el:*/,://,b:#,:%,:XCOMM,n:>,fb:-
 | 
						||
  set   comments=b:#,:%,fb:-,n:>,n:)
 | 
						||
"
 | 
						||
"       cpoptions you should get to know - source of many FAQs!  ;-)
 | 
						||
"       cpoptions:  "compatible options" to match Vi behaviour
 | 
						||
" set   cpoptions="aABceFs"   "default!
 | 
						||
"       FAQ:  Do NOT include the flag '<' if you WANT angle notation!
 | 
						||
"
 | 
						||
"       dictionary: english words first
 | 
						||
  set   dictionary=/usr/dict/words,/local/lib/german.words
 | 
						||
"
 | 
						||
"       digraph:    required for those umlauts
 | 
						||
  set   digraph
 | 
						||
"
 | 
						||
"       errorbells: damn this beep!  ;-)
 | 
						||
  set noerrorbells
 | 
						||
 | 
						||
"       esckeys:    allow usage of cursor keys within insert mode
 | 
						||
  set   esckeys
 | 
						||
"
 | 
						||
"       formatoptions:  Options for the "text format" command ("gq")
 | 
						||
"                       I need all those options (but 'o')!
 | 
						||
  set   formatoptions=cqrt
 | 
						||
"
 | 
						||
"       helpheight: zero disables this.
 | 
						||
  set   helpheight=0
 | 
						||
"
 | 
						||
"       helpfile:  filename of the helpfile
 | 
						||
" set   helpfile=c:\\vim-4.6\\docs\\help.txt
 | 
						||
"       this is where I usually put it on DOS; sometimes is required
 | 
						||
"       to set as the default installation does not find it  :-(
 | 
						||
"
 | 
						||
"       hidden:
 | 
						||
  set   hidden
 | 
						||
"
 | 
						||
"       highlight=8b,db,es,hs,mb,Mn,nu,rs,sr,tb,vr,ws
 | 
						||
  set   highlight=8r,db,es,hs,mb,Mr,nu,rs,sr,tb,vr,ws
 | 
						||
"
 | 
						||
"       hlsearch :  highlight search - show the current search pattern
 | 
						||
"       This is a nice feature sometimes - but it sure can get in the
 | 
						||
"       way sometimes when you edit.
 | 
						||
  set nohlsearch
 | 
						||
"
 | 
						||
"       icon:       ...
 | 
						||
  set noicon
 | 
						||
"
 | 
						||
" set   iconstring  file of icon (Sven doesn't use an icon)
 | 
						||
" set   iconstring
 | 
						||
"
 | 
						||
"       ignorecase:  ignore the case in search patterns?  NO!
 | 
						||
  set noignorecase
 | 
						||
"
 | 
						||
"       insertmode:  start in insert mode?  Naah.
 | 
						||
  set noinsertmode
 | 
						||
"
 | 
						||
"
 | 
						||
"       iskeyword:  Add the dash ('-'), the dot ('.'), and the '@'
 | 
						||
"                   as "letters" to "words".
 | 
						||
"       iskeyword=@,48-57,_,192-255   (default)
 | 
						||
  set   iskeyword=@,48-57,_,192-255,-,.,@-@
 | 
						||
"
 | 
						||
"       joinspaces:  insert two spaces after a period with every
 | 
						||
"                joining of lines.  This is very nice!
 | 
						||
  set   joinspaces
 | 
						||
"
 | 
						||
"       keywordprg:  Program to use for the "K" command.
 | 
						||
" set   keywordprg=man\ -s
 | 
						||
"
 | 
						||
"       laststatus:  show status line?  Yes, always!
 | 
						||
"       laststatus:  Even for only one buffer.
 | 
						||
  set   laststatus=2
 | 
						||
"
 | 
						||
" [VIM5]lazyredraw:  do not update screen while executing macros
 | 
						||
  set   lazyredraw
 | 
						||
"
 | 
						||
"       magic:       use some magic in search patterns?  Certainly!
 | 
						||
  set   magic
 | 
						||
"
 | 
						||
"       modeline:    ...
 | 
						||
"       Allow the last line to be a modeline - useful when
 | 
						||
"       the last line in sig gives the preferred textwidth for replies.
 | 
						||
  set   modeline
 | 
						||
  set   modelines=1
 | 
						||
"
 | 
						||
"       number:      ...
 | 
						||
  set nonumber
 | 
						||
"
 | 
						||
"       path:   The list of directories to search when you specify
 | 
						||
"               a file with an edit command.
 | 
						||
"               Note:  "~/.P" is a symlink to my dir with www pages
 | 
						||
"               "$VIMRUNTIME/syntax" is where the syntax files are.
 | 
						||
  set   path=.,,~/.P/vim,~/.P/vim/syntax,~/.P/vim/source,$VIMRUNTIME/syntax/
 | 
						||
" set   path=.,,~/.P/vim,~/.P/mutt/,~/.P/elm,~/.P/slrn/,~/.P/nn
 | 
						||
"
 | 
						||
"       report: show a report when N lines were changed.
 | 
						||
"               report=0 thus means "show all changes"!
 | 
						||
  set   report=0
 | 
						||
"
 | 
						||
"       ruler:       show cursor position?  Yep!
 | 
						||
  set   ruler
 | 
						||
"
 | 
						||
" Setting the "shell" is always tricky - especially when you are
 | 
						||
" trying to use the same vimrc on different operatin systems.
 | 
						||
"       shell for DOS
 | 
						||
" set   shell=command.com
 | 
						||
"       shell for UNIX -  math.fu-berlin.de BSD
 | 
						||
" set   shell=zsh
 | 
						||
"       shell for UNIX -   inf.fu-berlin.de BSD&Solaris
 | 
						||
" set   shell=zsh
 | 
						||
"       shell for UNIX - zedat.fu-berlin.de BSD&Solaris
 | 
						||
" set   shell=/bin/tcsh
 | 
						||
"       zsh now available at zedat!  :-)
 | 
						||
" set   shell=zsh
 | 
						||
" Now that vim-5 has ":if" I am trying to automate the setting:
 | 
						||
"
 | 
						||
  if has("dos16") || has("dos32")
 | 
						||
  let shell='command.com'
 | 
						||
  endif
 | 
						||
  if has("unix")
 | 
						||
  let shell='zsh'
 | 
						||
  endif
 | 
						||
"
 | 
						||
"       shiftwidth:  Number of spaces to use for each
 | 
						||
"                    insertion of (auto)indent.
 | 
						||
  set   shiftwidth=8
 | 
						||
"
 | 
						||
"       shortmess:   Kind of messages to show.   Abbreviate them all!
 | 
						||
"          New since vim-5.0v: flag 'I' to suppress "intro message".
 | 
						||
  set   shortmess=at
 | 
						||
"
 | 
						||
"       showcmd:     Show current uncompleted command?  Absolutely!
 | 
						||
  set   showcmd
 | 
						||
"
 | 
						||
"       showmatch:   Show the matching bracket for the last ')'?
 | 
						||
  set   showmatch
 | 
						||
"
 | 
						||
"       showmode:    Show the current mode?  YEEEEEEEEESSSSSSSSSSS!
 | 
						||
  set   showmode
 | 
						||
"
 | 
						||
"       suffixes:    Ignore filename with any of these suffixes
 | 
						||
"                    when using the ":edit" command.
 | 
						||
"                    Most of these are files created by LaTeX.
 | 
						||
  set   suffixes=.aux,.bak,.dvi,.gz,.idx,.log,.ps,.swp,.tar
 | 
						||
"
 | 
						||
"       startofline:  no:  do not jump to first character with page
 | 
						||
"       commands, ie keep the cursor in the current column.
 | 
						||
  set nostartofline
 | 
						||
"
 | 
						||
"       tabstop
 | 
						||
  set   tabstop=8
 | 
						||
"
 | 
						||
"
 | 
						||
" Set the colors for vim on "xterm"
 | 
						||
  if &term=="xterm"
 | 
						||
    set t_Co=8          " "terminal has eight colors"
 | 
						||
    set t_Sb=[4%dm    " escape sequence for background
 | 
						||
    set t_Sf=[3%dm    " escape sequence for foreground
 | 
						||
"   source ~/.P/vim/syntax/colors.vim
 | 
						||
"   http://www.math.fu-berlin.de/~guckes/vim/syntax/colors.vim
 | 
						||
" [todo] Add this to the Vim FAQ
 | 
						||
  endif
 | 
						||
"
 | 
						||
"       textmode:    no - I am using Vim on UNIX!
 | 
						||
  set notextmode
 | 
						||
"
 | 
						||
"       textwidth
 | 
						||
  set   textwidth=79
 | 
						||
"
 | 
						||
"       title:
 | 
						||
  set notitle
 | 
						||
"
 | 
						||
"       ttyfast:     are we using a fast terminal?
 | 
						||
"                    seting depends on where I use Vim...
 | 
						||
  set nottyfast
 | 
						||
"
 | 
						||
"       ttybuiltin:
 | 
						||
  set nottybuiltin
 | 
						||
"
 | 
						||
"       ttyscroll:      turn off scrolling -> faster!
 | 
						||
  set   ttyscroll=0
 | 
						||
"
 | 
						||
"       ttytype:
 | 
						||
" set   ttytype=rxvt
 | 
						||
"
 | 
						||
"       viminfo:  What info to store from an editing session
 | 
						||
"                 in the viminfo file;  can be used at next session.
 | 
						||
  set   viminfo=%,'50,\"100,:100,n~/.viminfo
 | 
						||
"
 | 
						||
"       visualbell:
 | 
						||
  set   visualbell
 | 
						||
"
 | 
						||
"       t_vb:  terminal's visual bell - turned off to make Vim quiet!
 | 
						||
"       Please use this as to not annoy cow-orkers in the same room.
 | 
						||
"       Thankyou!  :-)
 | 
						||
  set   t_vb=
 | 
						||
"
 | 
						||
"       whichwrap:
 | 
						||
  set   whichwrap=<,>
 | 
						||
"
 | 
						||
"       wildchar  the char used for "expansion" on the command line
 | 
						||
"                 default value is "<C-E>" but I prefer the tab key:
 | 
						||
  set   wildchar=<TAB>
 | 
						||
"
 | 
						||
"       wrapmargin:
 | 
						||
  set   wrapmargin=1
 | 
						||
"
 | 
						||
"       writebackup:
 | 
						||
  set nowritebackup
 | 
						||
"
 | 
						||
" ===================================================================
 | 
						||
" ABbreviations
 | 
						||
" ===================================================================
 | 
						||
" 980701: Moved the abbreviations *before* the mappings as
 | 
						||
" some of the abbreviations get used with some mappings.
 | 
						||
"
 | 
						||
" Abbreviations for some important numbers:
 | 
						||
  iab Npi 3.1415926535897932384626433832795028841972
 | 
						||
  iab Ne  2.7182818284590452353602874713526624977573
 | 
						||
"
 | 
						||
" Abbreviations for some classic long words:
 | 
						||
"
 | 
						||
"     Donau... is the German word for the (read in reverse)
 | 
						||
"     "additional paragraph of the law regulating the pension of
 | 
						||
"      widows to captains of the ship company on (the river) Danube"
 | 
						||
"     (I am not making this up! ;-)
 | 
						||
  iab YDD Donaudampfschiffahrtgesellschaftskapitaenwitwenrentengesetzzusatzparagraph
 | 
						||
"
 | 
						||
"     YLL : The name of a town in Wales.  I am not making this up!
 | 
						||
  iab YLL    LLanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch
 | 
						||
" http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.co.uk
 | 
						||
" http://194.159.85.168/ - I am not making this up!  :-)
 | 
						||
"
 | 
						||
"     YTauma: The name of a hill in New Zealand.
 | 
						||
  iab YTauma Taumatawhakatangihangakoauauotamateaturipukakapikimaungahoronukupokaiwenuakitanatahu
 | 
						||
"
 | 
						||
"     Yalpha : The lower letter alphabet.
 | 
						||
  iab Yalpha abcdefghijklmnopqrstuvwxyz
 | 
						||
"
 | 
						||
"     YALPHA : The upper letter alphabet.
 | 
						||
  iab YALPHA ABCDEFGHIJKLMNOPQRSTUVWXYZ
 | 
						||
"
 | 
						||
"     Ydigit : The ten digits.
 | 
						||
  iab Ydigit 1234567890
 | 
						||
"
 | 
						||
"     Yruler : A ruler.
 | 
						||
  iab Yruler 1234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890
 | 
						||
"
 | 
						||
"     Yupsidedown : This describes people from "down under"
 | 
						||
"                   (Hi, Dean!).
 | 
						||
  iab Yupsidedown umop-ap!sdn
 | 
						||
"
 | 
						||
"     Ysuper: A nice long word from the musical "Mary Poppins".
 | 
						||
  iab Ysuper supercalifragilisticexpialidocious
 | 
						||
 | 
						||
"     Yanti:  The longest proper word in the English language?!
 | 
						||
  iab Yanti antidisestablishmentarianism
 | 
						||
"
 | 
						||
"     Ypass : Standard answer to Usenet posts
 | 
						||
"             with the "Subject: HELP"  (hehe)
 | 
						||
  iab Ypass "You are in a maze of twisty little passages, all alike."
 | 
						||
"
 | 
						||
"     Ysesqui : "Sesquipedalophobia" means "fear of big words."  ;-)
 | 
						||
  iab Ysesqui    sesquipedalophobia
 | 
						||
"
 | 
						||
" classic pangrams (which include every letter of the alphabet):
 | 
						||
" German:
 | 
						||
"   sylvia wagt quick den jux bei pforzheim
 | 
						||
"   bayerische jagdwitze von maxl querkopf
 | 
						||
"   zwei boxkaempfer jagen eva quer durch sylt
 | 
						||
"   kaufen sie jede woche vier gute bequeme pelze
 | 
						||
"   falsches <20>ben von xylophonmusik qu<71>lt jeden gr<67><72>eren zwerg.
 | 
						||
"   Bei jedem klugen Wort von Sokrates rief Xanthippe zynisch: Quatsch!
 | 
						||
" English:
 | 
						||
"        the quick brown fox jumps over the lazy dog
 | 
						||
" French:
 | 
						||
"        voyez le brick geant que j'examine pres du wharf.
 | 
						||
"
 | 
						||
"       And a sentence to break some quoing levels:
 | 
						||
"       "This man's house (which 's yellow) burned down."
 | 
						||
"
 | 
						||
"       And now for something completely different:
 | 
						||
"       I couldn't bear to bear bears over the border.
 | 
						||
"
 | 
						||
" Inserting an ellipsis to indicate deleted text
 | 
						||
  iab  Yell  [...]
 | 
						||
  vmap ,ell c[...]<ESC>
 | 
						||
"
 | 
						||
" Correcting those typos. [I almost never get these right.  :-(]
 | 
						||
" See also:  http://www.igd.fhg.de/~zach/programs/acl/
 | 
						||
  iab alos also
 | 
						||
  iab aslo also
 | 
						||
  iab charcter character
 | 
						||
  iab charcters characters
 | 
						||
  iab exmaple example
 | 
						||
  iab shoudl should
 | 
						||
  iab seperate separate
 | 
						||
  iab teh the
 | 
						||
" Some frequent typos in German:
 | 
						||
  iab nciht nicht
 | 
						||
  iab doer oder
 | 
						||
  iab Dreckfuhler Druckfehler
 | 
						||
" Sorry, Laurent!
 | 
						||
  iab Laurant Laurent
 | 
						||
"
 | 
						||
" See http://www.math.fu-berlin.de/~guckes/sig/:
 | 
						||
  iab YDDS dash-dash-space
 | 
						||
"
 | 
						||
" For reports and texts on my studies:
 | 
						||
  iab YKT Komplexitaetstheorie
 | 
						||
  iab YRA Rechnerarchitektur
 | 
						||
  iab YPM Pattern Matching
 | 
						||
" see http://elib.zib.de/ICM98 :
 | 
						||
  iab YICM International Congress of Mathematicians
 | 
						||
"
 | 
						||
" Some sentences that I really use often in emails about Vim:
 | 
						||
  iab YAW You are welcome!  :-)
 | 
						||
  iab YEV Enjoy Vim!
 | 
						||
"
 | 
						||
" Often used filenames - only needed these on the command line:
 | 
						||
" see also:  http://www.math.fu-berlin.de/~guckes/setup/
 | 
						||
"
 | 
						||
  cab ELMALIAS  ~/.elm/aliases.text
 | 
						||
  cab Erc       ~/.elm/elmrc
 | 
						||
  cab Mrc       ~/.muttrc
 | 
						||
  cab Src       ~/.slrnrc
 | 
						||
  cab Zrc       ~/.zsh/.zshrc
 | 
						||
  cab SIGs      ~/.P/sig/SIGS
 | 
						||
"
 | 
						||
" A list of filenames that are needed to shorten some autocommands:
 | 
						||
" cab MAILNEWSFILES .article,.followup,.letter,mutt*[0-9],/postpone/*
 | 
						||
" cab MAILNEWSFILES *.article,*.followup,*.letter,*mutt*
 | 
						||
  let MAILNEWSFILES = "*.article,*.followup,*.letter,mutt*"
 | 
						||
"
 | 
						||
" see also:  http://www.math.fu-berlin.de/~guckes/sig/SIGS
 | 
						||
"
 | 
						||
"  Email Adresses:
 | 
						||
"  I usually use these when adding addresses to the header
 | 
						||
"  of emails (mutt) and posts (slrn).
 | 
						||
"
 | 
						||
"             Author of the Good NetKeeping Seal of Approval:
 | 
						||
  ab Agnksa   js@xs4all.nl (Jeroen Scheerder)
 | 
						||
"
 | 
						||
"             Author of Mutt:
 | 
						||
  ab Amutt    me@cs.hmc.edu (Michael Elkins)
 | 
						||
"
 | 
						||
"             Author of Slrn:
 | 
						||
  ab Aslrn    davis@space.mit.edu (John E. Davis)
 | 
						||
"
 | 
						||
"             Author of Vim:
 | 
						||
" ab Avim     mool@oce.nl (Bram Moolenaar)
 | 
						||
  ab Avim     bram@vim.org (Bram Moolenaar)
 | 
						||
"
 | 
						||
"             Former Maintainer of the Vim FAQ:
 | 
						||
  ab Avimfaq  laurent@Grafnetix.COM (Laurent Duperval)
 | 
						||
"
 | 
						||
"    Mailing Lists (MLs)
 | 
						||
"
 | 
						||
"    The Vim mailing lists: See http://www.vim.org/mail.html for more info!
 | 
						||
  ab MLvim      vim@vim.org (VIM Help List)
 | 
						||
  ab MLvimdev   vim-dev@vim.org (VIM Development List)
 | 
						||
  ab MLvimmac   guckes-vimmac@math.fu-berlin.de (VIM on MacOS Development List)
 | 
						||
"
 | 
						||
" More mailing lists:
 | 
						||
  ab MLgnksa    gnksa-workers@babayaga.math.fu-berlin.de (GNKSA Workers List)
 | 
						||
  ab MLmuttdev  mutt-dev@mutt.org (Mutt Developer List)
 | 
						||
  ab MLmuttuser mutt-users@mutt.org (Mutt USers List)   
 | 
						||
  ab MLzsh      zsh-users@math.gatech.edu (ZShell Users List)
 | 
						||
"
 | 
						||
"
 | 
						||
"   News: newsgroup names
 | 
						||
"
 | 
						||
" Newsgroup about "warloding" of signatures - see
 | 
						||
" also http://www.math.fu-berlin.de/~guckes/afw/
 | 
						||
  iab Nafw    alt.fan.warlord
 | 
						||
  iab Nahbou  alt.humor.best-of-usenet
 | 
						||
  iab Nzedat  bln.announce.fub.zedat.d
 | 
						||
  iab Ncsd    bln.announce.fub.cs.d
 | 
						||
  iab Nce     comp.editors
 | 
						||
" Newsgroup about "lynx":
 | 
						||
  iab Nhtml   comp.infosystems.www.authoring.html
 | 
						||
" Newsgroup about "elm":  Elm is dead - long live Mutt!
 | 
						||
  iab Nelm    comp.mail.elm
 | 
						||
" Newsgroup about "pine":  When will they release pine-4?
 | 
						||
" iab Ncmp    comp.mail.pine
 | 
						||
  iab Npine   comp.mail.pine
 | 
						||
" iab Ncsmd   comp.sys.mac.digest
 | 
						||
" Newsgroup about "mobil phone systems":
 | 
						||
  iab Ndcm    de.comm.mobil
 | 
						||
  iab Nmobil  de.comm.mobil
 | 
						||
" Newsgroup about "web browsers":
 | 
						||
  iab Nlynx     comp.infosystems.www.browsers.misc
 | 
						||
  iab Nnetscape comp.infosystems.www.browsers.misc
 | 
						||
" Newsgroup about "mutt" [since 980401]:  The coolest mail user agent
 | 
						||
  iab Nmutt   comp.mail.mutt
 | 
						||
" Newsgroup about "nn":  Once was the best newsreader. Still good.
 | 
						||
  iab Nnn     news.software.nn
 | 
						||
" Newsgroup for "newbies".
 | 
						||
" All you ever wanted to know - but were afraid to ask. ;-)
 | 
						||
  iab Newbie  news.newusers.questions
 | 
						||
" Newsgroup about "newsreader *agents*" (netscape and slrn):
 | 
						||
  iab Nnsr    news.software.readers
 | 
						||
"
 | 
						||
" Usenet header lines (used when composing a post):
 | 
						||
"
 | 
						||
  iab UFT  Followup-To:
 | 
						||
  iab UMCT Mail-Copies-To: MYADDR
 | 
						||
  iab UNG  Newsgroups:
 | 
						||
  iab URT  Reply-To: MYADDR
 | 
						||
  iab UFUB Organization: Freie Universitaet Berlin
 | 
						||
"
 | 
						||
" Current version numbers of my favourite programs:
 | 
						||
" http://www.math.fu-berlin.de/~guckes/sig/SIGS
 | 
						||
" And some abbreviations to type them in mail&news:
 | 
						||
"
 | 
						||
  iab Velm  ELM2.4PL25 [951204]
 | 
						||
  iab VElm  ELM2.5b2 [980213]
 | 
						||
  iab Vlynx lynx-2.8.0 [980310
 | 
						||
  iab Vmutt mutt-0.92.8 [980514]
 | 
						||
  iab Vslrn slrn-0.9.5.2 [980503]
 | 
						||
  iab Vvim  vim-5.1  [980407]
 | 
						||
  iab Vvimdev vim-5.2c [980518]
 | 
						||
"
 | 
						||
" For current version numbers take a look at my signature file:
 | 
						||
" http://www.math.fu-berlin.de/~guckes/sig/SIGS
 | 
						||
"
 | 
						||
"  My snail mail address, phone numbers, and email->pager gateway:
 | 
						||
"  Postcards and FAXes are welcome (especially with cartoons :-).
 | 
						||
"  If you want, you can send a message to my pager by email, too.
 | 
						||
  iab Ypager To: ums@teco.edu<C-M>Subject: PAGE:01777777796
 | 
						||
  iab Yphone TEL/FAX   (+49  30) 8838884<C-M>Cellphone (+49 177) 7777796
 | 
						||
  iab Ysnail Sven Guckes<C-M>Pariser Str. 52<C-M>D-10719 Berlin
 | 
						||
"
 | 
						||
"  My addresses (Email and WWW)
 | 
						||
"
 | 
						||
  ab Amaili guckes@inf.fu-berlin.de
 | 
						||
  ab Amailm guckes@math.fu-berlin.de
 | 
						||
  ab Amailv guckes@vim.org
 | 
						||
  ab Amailz guckes@zedat.fu-berlin.de
 | 
						||
  ab MYADDR guckes@math.fu-berlin.de
 | 
						||
"
 | 
						||
" Setting the reply address when replying as the guy from SKB:
 | 
						||
  ab ASKB   Sprachboerse <sprachboerse@tu-berlin.de>
 | 
						||
" See also: http://www.math.fu-berlin.de/~guckes/skb/
 | 
						||
"
 | 
						||
"  My Home Pages at the departments at the FUB
 | 
						||
"
 | 
						||
  ab WWWm   http://www.math.fu-berlin.de/~guckes/
 | 
						||
  ab WWWi   http://www.inf.fu-berlin.de/~guckes/
 | 
						||
  ab WWWz   http://userpage.zedat.fu-berlin.de/~guckes/
 | 
						||
"
 | 
						||
" WWW Pages base URLs
 | 
						||
"
 | 
						||
  ab HPA   http://www.math.fu-berlin.de/~guckes/afw/
 | 
						||
  ab HPa   http://www.math.fu-berlin.de/~guckes/ascii/
 | 
						||
  ab HPc   http://www.math.fu-berlin.de/~guckes/calvin/
 | 
						||
  ab HPD   http://www.math.fu-berlin.de/~guckes/dos/
 | 
						||
  ab HPe   http://www.math.fu-berlin.de/~guckes/eplus/ab.faq.html
 | 
						||
  ab HPE   http://www.math.fu-berlin.de/~guckes/elm/
 | 
						||
  ab HPI   http://www.math.fu-berlin.de/~guckes/irc/
 | 
						||
  ab HPi   http://www.math.fu-berlin.de/~guckes/ispell/
 | 
						||
  ab HPL   http://www.math.fu-berlin.de/~guckes/lynx/
 | 
						||
  ab HPl   http://www.math.fu-berlin.de/~guckes/less/
 | 
						||
  ab HPm   http://www.math.fu-berlin.de/~guckes/mail/
 | 
						||
  ab HPM   http://www.math.fu-berlin.de/~guckes/mutt/
 | 
						||
  ab HPN   http://www.math.fu-berlin.de/~guckes/nn/
 | 
						||
  ab HPP   http://www.math.fu-berlin.de/~guckes/pine/
 | 
						||
  ab HPp   http://www.math.fu-berlin.de/~guckes/procmail/
 | 
						||
  ab HPr   http://babayaga.math.fu-berlin.de/~rxvt/
 | 
						||
  ab HPR   http://www.math.fu-berlin.de/~guckes/rfc/
 | 
						||
  ab HPs   http://www.math.fu-berlin.de/~guckes/screen/
 | 
						||
  ab HPS   http://www.math.fu-berlin.de/~guckes/slrn/
 | 
						||
  ab HPv   http://www.math.fu-berlin.de/~guckes/vi/
 | 
						||
"    HPoV - "original" URL of the Vim Home Page
 | 
						||
  ab HPoV  http://www.math.fu-berlin.de/~guckes/vim/
 | 
						||
  ab HPV   http://www.vim.org/
 | 
						||
  ab HPX   http://www.math.fu-berlin.de/~guckes/xmas/
 | 
						||
  ab HPZ   http://www.math.fu-berlin.de/~guckes/zsh/
 | 
						||
"
 | 
						||
" Other important WWW addresses
 | 
						||
"
 | 
						||
  ab URLutefuchs  http://www.math.fu-berlin.de/~utefuchs/
 | 
						||
  ab URLaltavista http://altavista.digital.com/
 | 
						||
  ab URLftpsearch http://ftpsearch.ntnu.no/ftpsearch/
 | 
						||
  ab URLvimfaq    http://www.grafnetix.com/~laurent/vim/faq.html
 | 
						||
  ab URLbambi     http://www.math.fu-berlin.de/~leitner/CnH/bambi.html
 | 
						||
  ab URLsecret    http://www.math.fu-berlin.de/~leitner/CnH/secret.html
 | 
						||
  ab URLwhome     http://www.math.fu-berlin.de/~leitner/CnH/who.me.html
 | 
						||
  ab URLstopspam  http://www.math.fu-berlin.de/~guckes/pics/stop.this.spam.jpg
 | 
						||
  ab FTPFUB       ftp://ftp.fu-berlin.de/
 | 
						||
  ab FTPVIM       ftp://ftp.fu-berlin.de/pub/misc/editors/vim/
 | 
						||
"
 | 
						||
" ===================================================================
 | 
						||
" Abbreviations - Header Lines for Email and News
 | 
						||
" ===================================================================
 | 
						||
" Define regexpr for headers to use with mappings
 | 
						||
" as it makes reading the mappings much easier:
 | 
						||
" cab HADDR     From\\|Cc\\|To
 | 
						||
  cab HEMAIL ^\(From\\|Cc\\|To\\|Date\\|Subject\\|Message-ID\\|Message-Id\\|X-\)
 | 
						||
  cab HNEWS  ^\(From\\|Cc\\|To\\|Date\\|Subject\\|Message-ID\\|X-\\|Newsgroups\)
 | 
						||
"
 | 
						||
" ===================================================================
 | 
						||
" Abbreviations - General Editing - Inserting Dates and Times
 | 
						||
" ===================================================================
 | 
						||
"
 | 
						||
" First, some command to add date stamps (with and without time).
 | 
						||
" I use these manually after a substantial change to a webpage.
 | 
						||
" [These abbreviations are used with the mapping for ",L".]
 | 
						||
"
 | 
						||
  iab Ydate <C-R>=strftime("%y%m%d")<CR>
 | 
						||
" Example: 971027
 | 
						||
"
 | 
						||
  iab Ytime <C-R>=strftime("%H:%M")<CR>
 | 
						||
" Example: 14:28
 | 
						||
"
 | 
						||
  iab YDT   <C-R>=strftime("%y%m%d %T")<CR>
 | 
						||
" Example: 971027 12:00:00
 | 
						||
"
 | 
						||
  iab YDATE <C-R>=strftime("%a %b %d %T %Z %Y")<CR>
 | 
						||
" Example: Tue Dec 16 12:07:00 CET 1997
 | 
						||
"
 | 
						||
" On Windows the functions "strftime" seems to have a different
 | 
						||
" format.  Therefore the following may be necessary:  [980730]
 | 
						||
" if !has("unix")
 | 
						||
" iab YDATE <C-R>=strftime("%c %a")<CR>
 | 
						||
" else
 | 
						||
" iab YDATE <C-R>=strftime("%D %T %a")<CR>
 | 
						||
" endif
 | 
						||
"
 | 
						||
" ===================================================================
 | 
						||
" MAPpings
 | 
						||
" ===================================================================
 | 
						||
" Caveat:  Mapping must be "prefix free", ie no mapping must be the
 | 
						||
" prefix of any other mapping.  Example:  "map ,abc foo" and
 | 
						||
" "map ,abcd bar" will give you the error message "Ambigous mapping".
 | 
						||
"
 | 
						||
" The backslash ('\') is the only(?) unmapped key, so this is the best
 | 
						||
" key to start mappings with as this does not take away a command key.
 | 
						||
" However, the backslash is never in the same position with keyboards.
 | 
						||
" Eg on German keyboards it is AltGr-sz - don't ask.
 | 
						||
" Anyway, I have decided to start mappings with the comma as this
 | 
						||
" character is always on the same position on almost all keyboards
 | 
						||
" and I hardly have a need for that command.
 | 
						||
"
 | 
						||
" The following maps get rid of some basic problems:
 | 
						||
"
 | 
						||
" With Vim-4 the format command was just 'Q' and
 | 
						||
" I am too used to it.  So I need this back!
 | 
						||
  nnoremap Q gq
 | 
						||
  vnoremap Q gq
 | 
						||
"
 | 
						||
" 980527 I often reformat a paragraph to fit some textwidth -
 | 
						||
" and I use the following mapping to adjust it to the
 | 
						||
" current position of the cursor:
 | 
						||
  map #tw :set textwidth=<C-R>=col(".")<C-M>
 | 
						||
"
 | 
						||
" "tal" is the "trailer alignment" filter program
 | 
						||
" Hopefully it will ship with Vim one day.
 | 
						||
" vmap #t !tal<CR>
 | 
						||
" vmap #t !tal -p 0<CR>
 | 
						||
"
 | 
						||
" Disable the command 'K' (keyword lookup) by mapping it
 | 
						||
" to an "empty command".  (thanks, Lawrence! :-):
 | 
						||
" map K :<CR>
 | 
						||
  map K :<BS>
 | 
						||
"
 | 
						||
" Disable the suspend for ^Z.
 | 
						||
" I use Vim under "screen" where a suspend would lose the
 | 
						||
" connection to the " terminal - which is what I want to avoid.
 | 
						||
  map <C-Z> :shell
 | 
						||
"
 | 
						||
" Make CTRL-^ rebound to the *column* in the previous file
 | 
						||
  noremap <C-^> <C-^>`"
 | 
						||
"
 | 
						||
" Make "gf" rebound to last cursor position (line *and* column)
 | 
						||
  noremap gf gf`"
 | 
						||
"
 | 
						||
" When I let Vim write the current buffer I frequently mistype the
 | 
						||
" command ":w" as ":W" - so I have to remap it to correct this typo:
 | 
						||
  nmap :W :w
 | 
						||
"
 | 
						||
" Are you used to the Unix commands "alias" and "which"?
 | 
						||
" I sometimes use these to look up my abbreviations and mappings.
 | 
						||
" So I need them available on the command line:
 | 
						||
  map :alias map
 | 
						||
  map :which map
 | 
						||
"
 | 
						||
" The command {number}CTRL-G show the current nuffer number, too.
 | 
						||
" This is yet another feature that vi does not have.
 | 
						||
" As I always want to see the buffer number I map it to CTRL-G.
 | 
						||
" Pleae note that here we need to prevent a loop in the mapping by
 | 
						||
" using the comamnd "noremap"!
 | 
						||
  noremap <C-G> 2<C-G>
 | 
						||
"
 | 
						||
" 980311  Sourcing syntax files
 | 
						||
" My personal syntax files are in ~/.P/vim/syntax/
 | 
						||
" and I need a quick way to edit and source them.
 | 
						||
  map ,SO :so ~/.P/vim/syntax/
 | 
						||
"
 | 
						||
" 980706  Sourcing syntax files from the distribution
 | 
						||
" A nice and fast way to both source syntax files
 | 
						||
" and to take a look at "what's there":
 | 
						||
  map ,V  :so $VIMRUNTIME/syntax/
 | 
						||
"
 | 
						||
" ===================================================================
 | 
						||
" Customizing the command line
 | 
						||
" ===================================================================
 | 
						||
" Valid names for keys are:  <Up> <Down> <Left> <Right> <Home> <End>
 | 
						||
" <S-Left> <S-Right> <S-Up> <PageUp> <S-Down> <PageDown>  <LeftMouse>
 | 
						||
"
 | 
						||
" Many shells allow editing in "Emacs Style".
 | 
						||
" Although I love Vi, I am quite used to this kind of editing now.
 | 
						||
" So here it is - command line editing commands in emacs style:
 | 
						||
  cnoremap <C-A> <Home>
 | 
						||
  cnoremap <C-F> <Right>
 | 
						||
  cnoremap <C-B> <Left>
 | 
						||
  cnoremap <ESC>b <S-Left>
 | 
						||
  cnoremap <ESC>f <S-Right>
 | 
						||
  cnoremap <ESC><C-H> <C-W>
 | 
						||
"
 | 
						||
" Additional codes for that "English" keyboard at the Xterminal
 | 
						||
  cnoremap <ESC>[D <S-Left>
 | 
						||
  cnoremap <ESC>[C <S-Right>
 | 
						||
"
 | 
						||
" Some editing is helpful in insert mode, too:
 | 
						||
  inoremap <C-F> <Right>
 | 
						||
  inoremap <C-B> <Left>
 | 
						||
"
 | 
						||
" Make the up and down movements move by "display/screen lines":
 | 
						||
"      map j      gj
 | 
						||
"      map <Down> gj
 | 
						||
"      map k      gk
 | 
						||
"      map <Up>   gk
 | 
						||
"
 | 
						||
" ===================================================================
 | 
						||
" VIM - Editing and updating the vimrc:
 | 
						||
" As I often make changes to this file I use these commands
 | 
						||
" to start editing it and also update it:
 | 
						||
  if has("unix")
 | 
						||
    let vimrc='~/.vimrc'
 | 
						||
  else
 | 
						||
" ie:  if has("dos16") || has("dos32") || has("win32")
 | 
						||
    let vimrc='$VIM\_vimrc'
 | 
						||
  endif
 | 
						||
  nn  ,u :source <C-R>=vimrc<CR><CR>
 | 
						||
  nn  ,v :edit   <C-R>=vimrc<CR><CR>
 | 
						||
"     ,v = vimrc editing (edit this file)
 | 
						||
" map ,v :e ~/.vimrc<CR>
 | 
						||
"     ,u = "update" by reading this file
 | 
						||
" map ,u :source ~/.vimrc<CR>
 | 
						||
" ===================================================================
 | 
						||
"
 | 
						||
" General Editing
 | 
						||
"
 | 
						||
" Define "del" char to be the same backspace (saves a LOT of trouble!)
 | 
						||
" As the angle notation cannot be use with the LeftHandSide
 | 
						||
" with mappings you must type this in *literally*!
 | 
						||
" map <C-V>127 <C-H>
 | 
						||
"cmap <C-V>127 <C-H>
 | 
						||
"
 | 
						||
"      ;rcm = remove "control-m"s - for those mails sent from DOS:
 | 
						||
  cmap ;rcm %s/<C-M>//g
 | 
						||
"
 | 
						||
"     Make whitespace visible:
 | 
						||
"     Sws = show whitespace
 | 
						||
  nmap ,Sws :%s/ /_/g<C-M>
 | 
						||
  vmap ,Sws :%s/ /_/g<C-M>
 | 
						||
"
 | 
						||
"     Sometimes you just want to *see* that trailing whitespace:
 | 
						||
"     Stws = show trailing whitespace
 | 
						||
  nmap ,Stws :%s/  *$/_/g<C-M>
 | 
						||
  vmap ,Stws :%s/  *$/_/g<C-M>
 | 
						||
"
 | 
						||
" General Editing - Turning umlauts into ascii (for German keyboards)
 | 
						||
"
 | 
						||
" imap <20> ae
 | 
						||
" imap <20> oe
 | 
						||
" imap <20> ue
 | 
						||
" imap <20> ss
 | 
						||
"
 | 
						||
" Ä -> <20>  :%s/\Ä/<2F>/gc  -> D
 | 
						||
" Ö -> <20>  :%s/\Ö/<2F>/gc  -> V
 | 
						||
" Ü -> <20>  :%s/\Ü/<2F>/gc  -> \
 | 
						||
" ä -> <20>  :%s/\ä/<2F>/gc  -> d
 | 
						||
" ö -> <20>  :%s/\ö/<2F>/gc  -> v
 | 
						||
" ü -> <20>  :%s/\ü/<2F>/gc  -> |
 | 
						||
"
 | 
						||
" ===================================================================
 | 
						||
" Inserting Dates and Times / Updating Date+Time Stamps
 | 
						||
" ===================================================================
 | 
						||
"     ,L  = "Last updated" - replace old time stamp with a new one
 | 
						||
"        preserving whitespace and using internal "strftime" command:
 | 
						||
"       requires the abbreviation  "YDATE"
 | 
						||
  map ,L  1G/Last update:\s*/e+1<CR>CYDATE<ESC>
 | 
						||
  map ,,L 1G/Last change:\s*/e+1<CR>CYDATE<ESC>
 | 
						||
" Example:
 | 
						||
" before:  "Last update:   Thu Apr  6 12:07:00 CET 1967"
 | 
						||
" after:   "Last update:   Tue Dec 16 12:07:00 CET 1997"
 | 
						||
"
 | 
						||
"     ,L  = "Last updated" - replace old time stamp with a new one
 | 
						||
"        using external "date" command (not good for all systems):
 | 
						||
" map ,L 1G/Last update: */e+1<CR>D:r!date<CR>kJ
 | 
						||
"
 | 
						||
" ===================================================================
 | 
						||
" General Editing - link to program "screen"
 | 
						||
" ===================================================================
 | 
						||
"
 | 
						||
"       ,Et = edit temporary file of "screen" program
 | 
						||
  map   ,Et :e /tmp/screen-exchange
 | 
						||
"       as a user of Unix systems you *must* have this program!
 | 
						||
"       see also:  http://www.math.fu-berlin.de/~guckes/screen/
 | 
						||
"
 | 
						||
" Email/News - Editing replies/followups
 | 
						||
"
 | 
						||
" Part 1 - prepare for editing
 | 
						||
"
 | 
						||
" Part 2 - getting rid of empty (quoted) lines and space runs.
 | 
						||
"
 | 
						||
"      ,cel = "clear empty lines"
 | 
						||
"       - delete contents of all lines which contain only whitespace.
 | 
						||
" map ,cel :g/^[<C-I> ]*$/d
 | 
						||
  map ,cel :%s/^\s\+$//
 | 
						||
"      ,del = "delete 'empty' lines"
 | 
						||
"       - delete all lines which contain only whitespace
 | 
						||
"         note:  this does *not* delete empty lines!
 | 
						||
  map ,del :g/^\s\+$/d
 | 
						||
"
 | 
						||
"      ,cqel = "clear quoted empty lines"
 | 
						||
"       Clears (makes empty) all lines which start with '>'
 | 
						||
"       and any amount of following spaces.
 | 
						||
" nmap ,cqel :%s/^[> ]*$//
 | 
						||
" vmap ,cqel  :s/^[> ]*$//
 | 
						||
  nmap ,cqel :%s/^[><C-I> ]\+$//
 | 
						||
  vmap ,cqel  :s/^[><C-I> ]\+$//
 | 
						||
" The following do not work as "\s" is not a character
 | 
						||
" and thus cannot be part of a "character set".
 | 
						||
" nmap ,cqel :%s/^[>\s]\+$//
 | 
						||
" vmap ,cqel  :s/^[>\s]\+$//
 | 
						||
"
 | 
						||
" Some people have strange habits within their writing.
 | 
						||
" But if you cannot educate them - rewrite their text!  ;-)
 | 
						||
"
 | 
						||
" Jason "triple-dots" King elephant@onaustralia.com.au
 | 
						||
" does uses ".." or "..." rather than the usual punctuation
 | 
						||
" (comma, semicolon, colon, full stop). So...
 | 
						||
"
 | 
						||
" Turning dot runs with following spaces into an end-of-sentence,
 | 
						||
" ie dot-space-space:
 | 
						||
  vmap ,dot :s/\.\+ \+/.  /g
 | 
						||
"
 | 
						||
" Gary Kline (kline@tera.tera.com) indents his
 | 
						||
" own text in replies with TAB or spaces.
 | 
						||
" Here's how to get rid of these indentation:
 | 
						||
  vmap ,gary :s/^>[ <C-I>]\+\([^>]\)/> \1/
 | 
						||
"
 | 
						||
"      ,ksr = "kill space runs"
 | 
						||
"             substitutes runs of two or more space to a single space:
 | 
						||
" nmap ,ksr :%s/  */ /g
 | 
						||
" vmap ,ksr  :s/  */ /g
 | 
						||
  nmap ,ksr :%s/  \+/ /g
 | 
						||
  vmap ,ksr  :s/  \+/ /g
 | 
						||
" Why can't the removal of space runs be
 | 
						||
" an option of "text formatting"? *hrmpf*
 | 
						||
"
 | 
						||
"    ,Sl = "squeeze lines"
 | 
						||
"    Turn all blocks of empty lines (within current visual)
 | 
						||
"    into *one* empty line:
 | 
						||
   map ,Sl :g/^$/,/./-j
 | 
						||
"
 | 
						||
" ===================================================================
 | 
						||
" Editing of email replies and Usenet followups - using autocommands
 | 
						||
" ===================================================================
 | 
						||
"
 | 
						||
" Remove ALL auto-commands.  This avoids having the
 | 
						||
" autocommands twice when the vimrc file is sourced again.
 | 
						||
  autocmd!
 | 
						||
"
 | 
						||
" set the textwidth to 70 characters for replies (email&usenet)
 | 
						||
  au BufRead .letter,mutt*,nn.*,snd.* set tw=78
 | 
						||
"
 | 
						||
" Try to use the mapping ",D" when doing a followup.
 | 
						||
" autocmd BufNewFile ~/.followup ,D|
 | 
						||
"
 | 
						||
" Part 3 - Change Quoting Level
 | 
						||
"
 | 
						||
"      ,dp = de-quote current inner paragraph
 | 
						||
"  map ,dp {jma}kmb:'a,'bs/^> //<CR>
 | 
						||
   map ,dp vip:s/^> //<CR>
 | 
						||
  vmap ,dp    :s/^> //<CR>
 | 
						||
"
 | 
						||
"      ,qp = quote current paragraph
 | 
						||
"            jump to first inner line, mark with 'a';
 | 
						||
"            jump to last  inner line, mark with 'b';
 | 
						||
"            then do the quoting as a substitution
 | 
						||
"            on the line range "'a,'b":
 | 
						||
"  map ,qp {jma}kmb:'a,'bs/^/> /<CR>
 | 
						||
"      vim-5 now has selection of "inner" and "all"
 | 
						||
"      of current text object - mapping commented!
 | 
						||
"
 | 
						||
"      ,qp = quote current paragraph (old version)
 | 
						||
"            jump to first inner line, Visual,
 | 
						||
"            jump to last  inner line,
 | 
						||
"            then do the quoting as a substitution:
 | 
						||
"  map ,qp {jV}k:s/^/> /<CR>
 | 
						||
"
 | 
						||
"      ,qp = quote current inner paragraph (works since vim-5.0q)
 | 
						||
"            select inner paragraph
 | 
						||
"            then do the quoting as a substitution:
 | 
						||
   map ,qp   vip:s/^/> /<CR>
 | 
						||
"
 | 
						||
"      ,qp = quote current paragraph
 | 
						||
"            just do the quoting as a substitution:
 | 
						||
  vmap ,qp    :s/^/> /<CR>
 | 
						||
 | 
						||
"
 | 
						||
" Changing quote style to *the* true quote prefix string "> ":
 | 
						||
"
 | 
						||
"       Fix Supercite aka PowerQuote (Hi, Andi! :-):
 | 
						||
"       before ,kpq:    >   Sven> text
 | 
						||
"       after  ,kpq:    > > text
 | 
						||
"      ,kpq kill power quote
 | 
						||
  vmap ,kpq :s/^> *[a-zA-Z]*>/> >/<C-M>
 | 
						||
"
 | 
						||
"       Fix various other quote characters:
 | 
						||
"      ,fq "fix quoting"
 | 
						||
  vmap ,fq :s/^> \([-":}\|][ <C-I>]\)/> > /
 | 
						||
"
 | 
						||
" Part 4 - Weed Headers of quoted mail/post
 | 
						||
"
 | 
						||
" These mappings make use of the abbreviation that define a list of
 | 
						||
" Email headers (HEMAIL) and News headers (HNEWS):
 | 
						||
  nmap ,we vip:v/HEMAIL/d
 | 
						||
  vmap ,we    :v/HEMAIL/d
 | 
						||
  nmap ,wp vip:v/HNEWS/d
 | 
						||
  vmap ,wp    :v/HNEWS/d
 | 
						||
"
 | 
						||
" Old versions for vim-4.6:
 | 
						||
"      ,we = "weed email header"
 | 
						||
" nmap ,we !ipegrep "^(Date:\|From \|From:\|Subject:\|To:\|$)"
 | 
						||
" vmap ,we   !egrep "^(Date:\|From \|From:\|Subject:\|To:\|$)"
 | 
						||
"      ,wp = "weed post header"
 | 
						||
" nmap ,wp !ipegrep "^(Date:\|From:\|Subject:\|Newsgroups:\|Followup-To:\|Keywords:\|References:\|Message-ID\|$)"
 | 
						||
" vmap ,wp   !egrep "^(Date:\|From:\|Subject:\|Newsgroups:\|Followup-To:\|Keywords:\|References:\|Message-ID\|$)"
 | 
						||
"
 | 
						||
"      ,ri = "Read in" basic lines from the email header
 | 
						||
"            Useful when replying to an email:
 | 
						||
" nmap ,ri :r!readmsg\|egrep "^From:\|^Subject:\|^Date:\|^To: \|^Cc:"
 | 
						||
"            NOTE: "readmsg" ships with the mailer ELM.
 | 
						||
"
 | 
						||
"
 | 
						||
" Part 5 - Reformatting Text
 | 
						||
"
 | 
						||
"  NOTE:  The following mapping require formatoptions to include 'r'
 | 
						||
"    and "comments" to include "n:>" (ie "nested" comments with '>').
 | 
						||
"
 | 
						||
"      ,b = break line in commented text (to be used on a space)
 | 
						||
" nmap ,b dwi<CR>> <ESC>
 | 
						||
  nmap ,b r<CR>
 | 
						||
"      ,j = join line in commented text
 | 
						||
"           (can be used anywhere on the line)
 | 
						||
" nmap ,j Jxx
 | 
						||
  nmap ,j Vjgq
 | 
						||
"
 | 
						||
"      ,B = break line at current position *and* join the next line
 | 
						||
" nmap ,B i<CR>><ESC>Jxx
 | 
						||
  nmap ,B r<CR>Vjgq
 | 
						||
"
 | 
						||
"      ,,, break current line at current column,
 | 
						||
"          inserting ellipsis and "filling space":
 | 
						||
  nmap ,,,  ,,1,,2
 | 
						||
  nmap ,,1  a...X...<ESC>FXr<CR>lmaky$o<CC-R>"<ESC>
 | 
						||
  nmap ,,2  :s/./ /g<C-M>3X0"yy$dd`a"yP
 | 
						||
"
 | 
						||
"
 | 
						||
" ===================================================================
 | 
						||
" Edit your reply!  (Or else!)
 | 
						||
" ===================================================================
 | 
						||
"
 | 
						||
" Part 6  - Inserting Special or Standard Text
 | 
						||
" Part 6a - The header
 | 
						||
 | 
						||
"    Add adresses for To: and Cc: lines
 | 
						||
"
 | 
						||
"     ,ca = check alias (reads in expansion of alias name)
 | 
						||
" map ,ca :r!elmalias -f "\%v (\%n)"
 | 
						||
"     ,Ca = check alias (reads in expansion of alias name)
 | 
						||
" map ,Ca :r!elmalias -f "\%n <\%v>"
 | 
						||
"
 | 
						||
"   ,cc = "copy notice"
 | 
						||
"   Insert a Cc line so that person will receive a "courtesy copy";
 | 
						||
"   this tells the addressee that text is a copy of a public article.
 | 
						||
"   This assumes that there is exactly one empty line after the first
 | 
						||
"   paragraph and the first line of the second paragraph contains the
 | 
						||
"   return address with a trailing colon (which is later removed).
 | 
						||
  map ,cc 1G}jyykPICc: <ESC>$x
 | 
						||
" map ,cc ma1G}jy/ writes<CR>'aoCc: <ESC>$p
 | 
						||
"
 | 
						||
"     ,mlu = make letter urgent  (by giving the "Priority: urgent")
 | 
						||
  map ,mlu 1G}OPriority: urgent<ESC>
 | 
						||
"
 | 
						||
"               Fixing the From: line
 | 
						||
"
 | 
						||
"     ,cS = change Sven's address.
 | 
						||
  map ,cS 1G/^From: Sven Guckes/e+2<CR>C<Amailv><ESC>
 | 
						||
"     Used when replying as the "guy from vim".
 | 
						||
"
 | 
						||
"               Fixing the Subject line
 | 
						||
"
 | 
						||
"    Pet peeve:  Unmeaningful Subject lines.  Change them!
 | 
						||
"     ,cs = change Subject: line
 | 
						||
  map ,cs 1G/^Subject: <CR>yypIX-Old-<ESC>-W
 | 
						||
"    This command keeps the old Subject line in "X-Old-Subject:" -
 | 
						||
"    so the recipient can still search for it and
 | 
						||
"    you keep a copy for editing.
 | 
						||
"
 | 
						||
"
 | 
						||
"     ,re : Condense multiple "Re:_" to just one "Re:":
 | 
						||
  map ,re 1G/^Sub<CR>:s/\(Re: \)\+/Re: /<CR>
 | 
						||
"
 | 
						||
"     ,Re : Change "Re: Re[n]" to "Re[n+1]" in Subject lines:
 | 
						||
  map ,Re 1G/^Subject: <C-M>:s/Re: Re\[\([0-9]\+\)\]/Re[\1]/<C-M><C-A>
 | 
						||
"
 | 
						||
" Put parentheses around "visual text"
 | 
						||
"      Used when commenting out an old subject.
 | 
						||
"      Example:
 | 
						||
"      Subject: help
 | 
						||
"      Subject: vim - using autoindent (Re: help)
 | 
						||
"
 | 
						||
"      ,) and ,( :
 | 
						||
  vmap ,( v`<i(<ESC>`>a)<ESC>
 | 
						||
  vmap ,) v`<i(<ESC>`>a)<ESC>
 | 
						||
"
 | 
						||
" Part 6  - Inserting Special or Standard Text
 | 
						||
" Part 6a - Start of text - saying "hello".
 | 
						||
"
 | 
						||
"     ,hi = "Hi!"        (indicates first reply)
 | 
						||
  map ,hi 1G}oHi!<CR><ESC>
 | 
						||
"
 | 
						||
"     ,ha = "helloagain"  (indicates reply to reply)
 | 
						||
  map ,ha 1G}oHello, again!<CR><ESC>
 | 
						||
"
 | 
						||
"     ,H = "Hallo, Du!"  (German equivalent of "hi!" for replies)
 | 
						||
  map ,H G/Quoting /e+1<CR>ye1G}oHallo, !<ESC>Po<ESC>
 | 
						||
"
 | 
						||
"
 | 
						||
" Part 6  - Inserting Special or Standard Text
 | 
						||
" Part 6b - End of text - dealing with "signatures".
 | 
						||
"
 | 
						||
"       remove signatures
 | 
						||
"
 | 
						||
"     ,kqs = kill quoted sig (to remove those damn sigs for replies)
 | 
						||
"          goto end-of-buffer, search-backwards for a quoted sigdashes
 | 
						||
"          line, ie "^> -- $", and delete unto end-of-paragraph:
 | 
						||
  map ,kqs G?^> -- $<CR>d}
 | 
						||
" map ,kqs G?^> *-- $<CR>dG
 | 
						||
"     ,kqs = kill quoted sig unto start of own signature:
 | 
						||
" map ,kqs G?^> *-- $<CR>d/^-- $/<C-M>
 | 
						||
"
 | 
						||
"      ,aq = "add quote"
 | 
						||
"            Reads in a quote from my favourite quotations:
 | 
						||
  nmap ,aq :r!agrep -d "^-- $" ~/.P/txt/quotes.favourite<ESC>b
 | 
						||
" see http://www.math.fu-berlin.de/~guckes/txt/quotes.favourite
 | 
						||
"
 | 
						||
"      ,s = "sign" -
 | 
						||
"           Read in signature file (requires manual completion):
 | 
						||
  nmap ,s :r!agrep -d "^-- $" ~/.P/sig/SIGS<S-Left>
 | 
						||
"
 | 
						||
" available as http://www.math.fu-berlin.de/~guckes/sig/SIGS
 | 
						||
"
 | 
						||
"      ,S = signature addition of frequently used signatures
 | 
						||
  nmap ,SE :r!agrep -d "^-- $" comp.mail.elm ~/.P/sig/SIGS<S-Left>
 | 
						||
  nmap ,SM :r!agrep -d "^-- $" WOOF ~/.P/sig/SIGS<S-Left>
 | 
						||
  nmap ,SV :r!agrep -d "^-- $" IMproved ~/.P/sig/SIGS<S-Left>
 | 
						||
"
 | 
						||
"      ,at = "add text" -
 | 
						||
"            read in text file (requires manual completion):
 | 
						||
  nmap ,at :r ~/.P/txt/
 | 
						||
"
 | 
						||
" MUTT: Auto-kill signatures for replies
 | 
						||
" map ,kqs G?^> *-- $<C-M>dG
 | 
						||
" autocmd BufRead .followup,.letter,mutt*,nn.*,snd.* :normal ,kqs
 | 
						||
"
 | 
						||
" At the end of editing your reply you should check your spelling
 | 
						||
" with the spelling checker "ispell".
 | 
						||
" These mappings are from Lawrence Clapp lclapp@iname.com:
 | 
						||
" spellcheck the document -- skip quoted text
 | 
						||
" nmap <F5> :w ! grep -v '^>' \| spell<CR>
 | 
						||
" vmap <F5> :w ! grep -v '^>' \| spell<CR>
 | 
						||
" At home under Linux it looks something more like this:
 | 
						||
" nmap <F5> :w ! grep -v '^>' \| ispell -???<CR>
 | 
						||
"
 | 
						||
"  Tell the recipient that I was replying to an old email of his:
 | 
						||
  ab SvenR Sven  [finally takeing the time to reply to old emails]
 | 
						||
"
 | 
						||
" Toggles:  [todo]
 | 
						||
"
 | 
						||
" toggle autoindent
 | 
						||
" toggle hlsearch
 | 
						||
" cycle textwidth between values 60, 70, 75, 80
 | 
						||
"
 | 
						||
" ===================================================================
 | 
						||
" HTML - HTML - HTML - HTML - HTML - HTML - HTML - HTML
 | 
						||
" ===================================================================
 | 
						||
" This has become quite big - so I moved it out to another file:
 | 
						||
" http://www.math.fu-berlin.de/~guckes/vim/source/html.vim [980227]
 | 
						||
  source ~guckes/.P/vim/source/html.vim
 | 
						||
"
 | 
						||
" ===================================================================
 | 
						||
" LaTeX - LaTeX - LaTeX - LaTeX - LaTeX - LaTeX - LaTeX
 | 
						||
" ===================================================================
 | 
						||
" This has become quite big - so I moved it out to another file:
 | 
						||
" http://www.math.fu-berlin.de/~guckes/vim/source/latex.vim
 | 
						||
" source ~guckes/.P/vim/source/latex.vim
 | 
						||
"
 | 
						||
" ===================================================================
 | 
						||
" PGP - encryption and decryption
 | 
						||
" ===================================================================
 | 
						||
"
 | 
						||
" encrypt
 | 
						||
  map ;e :%!/bin/sh -c 'pgp -feast 2>/dev/tty'
 | 
						||
" decrypt
 | 
						||
  map ;d :/^-----BEG/,/^-----END/!/bin/sh -c 'pgp -f 2>/dev/tty'
 | 
						||
" sign
 | 
						||
  map ;s :,$! /bin/sh -c 'pgp -fast +clear 2>/dev/tty'
 | 
						||
  map ;v :,/^-----END/w !pgp -m
 | 
						||
"
 | 
						||
" PGP - original mappings
 | 
						||
"
 | 
						||
"       encrypt and sign (useful for mailing to someone else)
 | 
						||
"csh: map #1 :,$! /bin/sh -c 'pgp -feast 2>/dev/tty^V|^V|sleep 4'
 | 
						||
" sh: map #1 :,$! pgp -feast 2>/dev/tty^V|^V|sleep 4
 | 
						||
"
 | 
						||
"       sign (useful for mailing to someone else)
 | 
						||
"csh: map #2 :,$! /bin/sh -c 'pgp -fast +clear 2>/dev/tty'
 | 
						||
" sh: map #2 :,$! pgp -fast +clear 2>/dev/tty
 | 
						||
"
 | 
						||
"       decrypt
 | 
						||
"csh: map #3 :/^-----BEG/,/^-----END/!\
 | 
						||
"             /bin/sh -c 'pgp -f 2>/dev/tty^V|^V|sleep 4'
 | 
						||
" sh: map #3 :/^-----BEG/,/^-----END/!\
 | 
						||
"             pgp -f 2>/dev/tty^V|^V|sleep 4
 | 
						||
"
 | 
						||
"       view (pages output, like more)
 | 
						||
"csh: map #4 :,/^-----END/w !pgp -m
 | 
						||
" sh: map #4 :,/^-----END/w !pgp -m
 | 
						||
"
 | 
						||
"       encrypt alone (useful for encrypting for oneself)
 | 
						||
"csh: map #5 :,$! /bin/sh -c 'pgp -feat 2>/dev/tty^V|^V|sleep 4'
 | 
						||
" sh: map #5 :,$! pgp -feat 2>/dev/tty^V|^V|sleep 4
 | 
						||
"
 | 
						||
" Elijah http://www.mathlab.sunysb.edu/~elijah/pgppub.html says :
 | 
						||
" The significant feature is that stderr is redirected independently
 | 
						||
" of stdout, and it is redirected to /dev/tty which is a synonym for
 | 
						||
" the current terminal on Unix.  I don't know why the ||sleep 4
 | 
						||
" stuff is there, but it is harmless so I left it. Since csh is such
 | 
						||
" junk, special rules are used if you are using it (tcsh, too).
 | 
						||
" ksh and bash should use the sh form. zsh, et al: consult your
 | 
						||
" manual.  The #<num> format is used to map function keys. If your
 | 
						||
" terminal does not support the requested function key, use a
 | 
						||
" literal #<num>.  Not all of the clones correctly support this.
 | 
						||
"
 | 
						||
" ===================================================================
 | 
						||
" Useful stuff.  At least these are nice examples.  :-)
 | 
						||
" ===================================================================
 | 
						||
"
 | 
						||
"     ,t = transpose two characters: from aXb -> bXa
 | 
						||
" map ,t XplxhhPl
 | 
						||
" This macros shortened by one character by
 | 
						||
" Preben Guldberg c928400@student.dtu.dk
 | 
						||
" map ,t XpxphXp
 | 
						||
" map ,t xphXpxp
 | 
						||
"
 | 
						||
" make space move the cursor to the right - much better than a *beep*
 | 
						||
" nmap \  l
 | 
						||
"
 | 
						||
"     ,E = execute line
 | 
						||
" map ,E 0/\$<CR>w"yy$:<C-R>y<C-A>r!<C-E>
 | 
						||
" This command excutes a shell command from the current line and
 | 
						||
" reads in its output into the buffer.  It assumes that the command
 | 
						||
" starts with the fist word after the first '$' (the shell prompt
 | 
						||
" of /bin/sh).  Try ",E" on that line, ie place the cursor on it
 | 
						||
" and then press ",E":
 | 
						||
" $ ls -la
 | 
						||
" Note: The command line commands have been remapped to tcsh style!!
 | 
						||
"
 | 
						||
"
 | 
						||
"      ,dr = decode/encode rot13 text
 | 
						||
  vmap ,dr :!tr A-Za-z N-ZA-Mn-za-m
 | 
						||
 | 
						||
"       Use this with an external "rot13" script:
 | 
						||
"       "    ,13 - rot13 the visual text
 | 
						||
"       vmap ,13 :!rot13<CR>
 | 
						||
"
 | 
						||
" Give the URL under the cursor to Netscape
 | 
						||
" map ,net yA:!netscape -remote "openurl <C-R>""
 | 
						||
"
 | 
						||
"
 | 
						||
" ===================================================================
 | 
						||
" Mapping of special keys - arrow keys and function keys.
 | 
						||
" ===================================================================
 | 
						||
" Buffer commands (split,move,delete) -
 | 
						||
" this makes a little more easy to deal with buffers.
 | 
						||
" (works for Linux PCs in room 030)
 | 
						||
  map <F4>  :split<C-M>
 | 
						||
  map <F5>  :bp<C-M>
 | 
						||
  map <F6>  :bn<C-M>
 | 
						||
  map <F12> :bd<C-M>
 | 
						||
"
 | 
						||
" Buffer commands (split,move,delete) -
 | 
						||
" for Mac keyboard (Performa 5200, US keyboard)
 | 
						||
"
 | 
						||
  map <ESC>[19~ :split<C-M>
 | 
						||
  map <ESC>[20~ :bp<C-M>
 | 
						||
  map <ESC>[23~ :bn<C-M>
 | 
						||
  map <ESC>[31~ :bd<C-M>
 | 
						||
"
 | 
						||
" Obvious mappings
 | 
						||
"
 | 
						||
" map <PageUp>   <C-B>
 | 
						||
" map <PageDown> <C-F>
 | 
						||
"
 | 
						||
" Emacs style editing in insert mode
 | 
						||
" This is something I tried for a minute
 | 
						||
" and forgot about the minute after. ;-)
 | 
						||
"
 | 
						||
" imap <C-A>  <ESC>0i
 | 
						||
" imap <C-B>  <ESC>hi
 | 
						||
" imap <C-D>  <ESC>xi
 | 
						||
" imap <C-E>  <ESC>A
 | 
						||
" imap <C-F>  <ESC>lli
 | 
						||
" imap <C-N>  <ESC>jli
 | 
						||
" imap <C-P>  <ESC>kli
 | 
						||
" imap <ESC>b <ESC>bi
 | 
						||
" imap <ESC>f <ESC>lWi
 | 
						||
"
 | 
						||
" Normal mode - tcsh style movements [960425]
 | 
						||
"
 | 
						||
" nmap <C-A>  0
 | 
						||
" nmap <C-B>  h
 | 
						||
" nmap <C-D>  x
 | 
						||
" nmap <C-E>  $
 | 
						||
" nmap <C-F>  l
 | 
						||
" nmap <ESC>b b
 | 
						||
" nmap <ESC>f w
 | 
						||
"
 | 
						||
" DOS keyboard mapping for cursor keys
 | 
						||
"
 | 
						||
"  map <ESC>[A <Up>
 | 
						||
"  map <ESC>[B <Down>
 | 
						||
"  map <ESC>[C <Right>
 | 
						||
"  map <ESC>[D <Left>
 | 
						||
" imap <ESC>[A <Up>
 | 
						||
" imap <ESC>[B <Down>
 | 
						||
" imap <ESC>[C <Right>
 | 
						||
" imap <ESC>[D <Left>
 | 
						||
"
 | 
						||
" DOS keyboard
 | 
						||
" "insert"
 | 
						||
"  map <ESC>[1~ i
 | 
						||
"  map <ESC>[1~ <insert>
 | 
						||
" "home"
 | 
						||
"  map <ESC>[2~ ^
 | 
						||
"  map <ESC>[2~ 0
 | 
						||
"  map <ESC>[2~ <Home>
 | 
						||
" "pgup"
 | 
						||
"  map <ESC>[3~ <C-B>
 | 
						||
"  map <ESC>[3~ <PageUp>
 | 
						||
" "delete"
 | 
						||
"  map <ESC>[4~ x
 | 
						||
"  map <ESC>[4~ <Del>
 | 
						||
" "end"
 | 
						||
"  map <ESC>[5~ $
 | 
						||
"  map <ESC>[5~ <END>
 | 
						||
" "pgdn"
 | 
						||
"  map <ESC>[6~ <C-F>
 | 
						||
"  map <ESC>[6~ <PageDown>
 | 
						||
"
 | 
						||
" Keyboard mapping for cursor keys
 | 
						||
" [works for SUNs in Solarium (room 030) - 970815]
 | 
						||
"
 | 
						||
   map <ESC>OA <Up>
 | 
						||
   map <ESC>OB <Down>
 | 
						||
   map <ESC>OC <Right>
 | 
						||
   map <ESC>OD <Left>
 | 
						||
  imap <ESC>OA <Up>
 | 
						||
  imap <ESC>OB <Down>
 | 
						||
  imap <ESC>OC <Right>
 | 
						||
  imap <ESC>OD <Left>
 | 
						||
"
 | 
						||
" Keyboard mapping for cursor keys
 | 
						||
" [works for XTerminals - 970818]
 | 
						||
   map <ESC>[A <Up>
 | 
						||
   map <ESC>[B <Down>
 | 
						||
   map <ESC>[C <Right>
 | 
						||
   map <ESC>[D <Left>
 | 
						||
  imap <ESC>[A <Up>
 | 
						||
  imap <ESC>[B <Down>
 | 
						||
  imap <ESC>[C <Right>
 | 
						||
  imap <ESC>[D <Left>
 | 
						||
"
 | 
						||
" ===================================================================
 | 
						||
" AutoCommands
 | 
						||
" ===================================================================
 | 
						||
"
 | 
						||
" Autocommands are the key to "syntax coloring".
 | 
						||
" There's one command in your vimrc that should
 | 
						||
" load/source the file $VIMRUNTIME/syntax/syntax.vim
 | 
						||
" which contains the definition for colors and
 | 
						||
" the autocommands that load other syntax files
 | 
						||
" when necessary, ie when the filename matches
 | 
						||
" a given pattern, eg "*.c" or *".html".
 | 
						||
"
 | 
						||
" just load the main syntax file when Vim was compiled with "+syntax"
 | 
						||
  if has("syntax")
 | 
						||
    " define my own syntax file (to be sourced t the end of syntax.vim):
 | 
						||
    " let mysyntaxfile="~guckes/.P/vim/syntax/syntax.vim"
 | 
						||
    " URL: http://www.math.fu-berlin.de/~guckes/vim/syntax/syntax.vim
 | 
						||
    " The main/standard syntax file:
 | 
						||
      so $VIMRUNTIME/syntax/syntax.vim
 | 
						||
    "
 | 
						||
    " Use my own syntax file on "mail/news messages":
 | 
						||
      let aucommand = "au BufRead ".MAILNEWSFILES
 | 
						||
"     exe aucommand." source ~guckes/.P/vim/syntax/sven.vim"
 | 
						||
    "
 | 
						||
      hi! Comment  term=bold  ctermfg=cyan  guifg=Blue
 | 
						||
  endif
 | 
						||
"
 | 
						||
"
 | 
						||
" EXAMPLE: Restricting mappings to some files only:
 | 
						||
" An autocommand does the macthign on the filenames -
 | 
						||
" but abbreviations are not expanded within autocommands.
 | 
						||
" Workaround:  Use "exe" for expansion:
 | 
						||
" let aucommand = "au BufRead ".MAILNEWSFILES
 | 
						||
" exe aucommand." :map ,hi 1G}oHi!<CR><ESC>"
 | 
						||
" exe aucommand." :map ,ha 1G}oHello, again!<CR><ESC>"
 | 
						||
" exe aucommand." :map ,H G/Quoting /e+1<CR>ye1G}oHallo, !<ESC>Po<ESC>"
 | 
						||
" exe aucommand." :map ,re 1G}oRe!<CR><ESC>"
 | 
						||
"
 | 
						||
" Automatically place the cursor onto the first line of the mail body:
 | 
						||
" autocmd BufRead MAILNEWSFILES :normal 1G}j
 | 
						||
"
 | 
						||
" Toggle syntax coloring on/off with "__":
 | 
						||
" nn __ mg:if has("syntax_items")<Bar>syn clear<CR>else<Bar>syn on<CR>en<CR>`g
 | 
						||
" Note:  It works - but the screen flashes are quite annoying.  :-/
 | 
						||
"
 | 
						||
"
 | 
						||
" ===================================================================
 | 
						||
" EXAMPLES
 | 
						||
" ===================================================================
 | 
						||
"
 | 
						||
" Visualizing trailing whitespace:
 | 
						||
" :set hls
 | 
						||
" /\s\+$
 | 
						||
"
 | 
						||
" Toggling a numerical variable between two values.
 | 
						||
" Example:  Switch the textwidth (tw) between values "70" and "80":
 | 
						||
" map \1 :let &tw = 150 - &tw<CR>
 | 
						||
"
 | 
						||
" Capitalizing the previously typed word,
 | 
						||
" returning to the previous position:
 | 
						||
" imap CAP <ESC>mzB~`za
 | 
						||
"
 | 
						||
" Uppercasing the previously typed word,
 | 
						||
" returning to the previous position:
 | 
						||
" imap CAP <ESC>mzvBU`za
 | 
						||
" imap CAP <ESC>mzBvaWU`za
 | 
						||
"
 | 
						||
" ===================================================================
 | 
						||
" TEMPORARY STUFF - TESTING THINGS
 | 
						||
" ===================================================================
 | 
						||
"
 | 
						||
"   View a html document (or part of it) with lynx. You need
 | 
						||
"   a system that supports the /def/fd/* file descriptors :-(
 | 
						||
"nmap ,ly :w !lynx -force_html /dev/fd/0<CR>
 | 
						||
"vmap ,ly :w !lynx -force_html /dev/fd/0<CR>
 | 
						||
"
 | 
						||
" Fri Jun 19 19:19:19 CEST 1998
 | 
						||
" Hi, Vikas! vikasa@att.com
 | 
						||
" The <Left> key produces the code "<Esc>OD" and Vikas wants to make
 | 
						||
" Vim jump back one word in normal mode, ie using the command 'b':
 | 
						||
" nmap <Esc>OD b
 | 
						||
" Works for me!  :-)
 | 
						||
"
 | 
						||
" Some simple example of the "expand modifiers":
 | 
						||
" insert the current filename *with* path:
 | 
						||
  iab YPATHFILE <C-R>=expand("%:p")<cr>
 | 
						||
" insert the current filename *without* path:
 | 
						||
  iab YFILE <C-R>=expand("%:t:r")<cr>
 | 
						||
" insert the path of current file:
 | 
						||
  iab YPATH <C-R>=expand("%:h")<cr>
 | 
						||
"
 | 
						||
"     #b = "browse" - send selected URL to Netscape
 | 
						||
 vmap #b y:!netscape -remote "openurl <C-R>""
 | 
						||
"
 | 
						||
" Toggle highlight search and report the current value:
 | 
						||
" map #1 :set hls!<cr>
 | 
						||
" map #2 :echo "HLSearch: " . strpart("OffOn",3*&hlsearch,3)<cr>
 | 
						||
" map ## #1#2
 | 
						||
"
 | 
						||
" Sorting current line containing a list of numbers
 | 
						||
" map ## :s/ /<C-M>/g<CR>vip!sort -n
 | 
						||
"
 | 
						||
" Replying to the mutt mailing list:
 | 
						||
" Remove header lines Cc: and Bcc: and insert [mutt] at the beginning
 | 
						||
" map ,MM 1G/^Cc:<CR>2dd}o[mutt]<CR>
 | 
						||
"
 | 
						||
" map ,U %s#<URL:\(.*\)>#<a href="\1"></a>#gc
 | 
						||
" map ,F {jma}kmb:'a,'b!sed -e "s/^>//"<C-V><C-V>|\
 | 
						||
"        sed -f ~/.P/elm/scripts/weedout.sed
 | 
						||
" map ,mb ebi<CR><b><ESC>Ea</b><CR><ESC>dw
 | 
						||
"
 | 
						||
" stripping netscape bookmarks and making them list items
 | 
						||
" vmap ,ns :.,$s/^ *<DT><\(A.*"\) ADD.*">\(.*\)$/<li> <\1><C-M><C-I>\2/
 | 
						||
"
 | 
						||
" Jump to the last space before the 80th column.
 | 
						||
" map ,\| 80\|F 
 | 
						||
"
 | 
						||
" extracting variable names from mutt's init.c
 | 
						||
" :%s/^.*"\([a-z0-9_]*\)".*$/\1/
 | 
						||
"
 | 
						||
"     \<> = change to <> notation by substituting ^M and ^[
 | 
						||
" cab \<> s/<C-V><ESC>/<ESC>/gc<C-M>:s/<C-V><C-M>/<C-M>/gc<C-M>
 | 
						||
"
 | 
						||
" Changing the From_ line in pseudo mail folders to an appropriate
 | 
						||
"  value - so you can read them with a mailer.
 | 
						||
" %s/^From /From guckes Thu Apr  6 12:07:00 1967/
 | 
						||
"
 | 
						||
" ===================================================================
 | 
						||
" ASCII tables - you may need them some day.  Save them to a file!
 | 
						||
" ===================================================================
 | 
						||
"
 | 
						||
" ASCII Table - | octal value - name/char |
 | 
						||
"
 | 
						||
" |000 nul|001 soh|002 stx|003 etx|004 eot|005 enq|006 ack|007 bel|
 | 
						||
" |010 bs |011 ht |012 nl |013 vt |014 np |015 cr |016 so |017 si |
 | 
						||
" |020 dle|021 dc1|022 dc2|023 dc3|024 dc4|025 nak|026 syn|027 etb|
 | 
						||
" |030 can|031 em |032 sub|033 esc|034 fs |035 gs |036 rs |037 us |
 | 
						||
" |040 sp |041  ! |042  " |043  # |044  $ |045  % |046  & |047  ' |
 | 
						||
" |050  ( |051  ) |052  * |053  + |054  , |055  - |056  . |057  / |
 | 
						||
" |060  0 |061  1 |062  2 |063  3 |064  4 |065  5 |066  6 |067  7 |
 | 
						||
" |070  8 |071  9 |072  : |073  ; |074  < |075  = |076  > |077  ? |
 | 
						||
" |100  @ |101  A |102  B |103  C |104  D |105  E |106  F |107  G |
 | 
						||
" |110  H |111  I |112  J |113  K |114  L |115  M |116  N |117  O |
 | 
						||
" |120  P |121  Q |122  R |123  S |124  T |125  U |126  V |127  W |
 | 
						||
" |130  X |131  Y |132  Z |133  [ |134  \ |135  ] |136  ^ |137  _ |
 | 
						||
" |140  ` |141  a |142  b |143  c |144  d |145  e |146  f |147  g |
 | 
						||
" |150  h |151  i |152  j |153  k |154  l |155  m |156  n |157  o |
 | 
						||
" |160  p |161  q |162  r |163  s |164  t |165  u |166  v |167  w |
 | 
						||
" |170  x |171  y |172  z |173  { |174  | |175  } |176  ~ |177 del|
 | 
						||
"
 | 
						||
" ===================================================================
 | 
						||
" ASCII Table - | decimal value - name/char |
 | 
						||
"
 | 
						||
" |000 nul|001 soh|002 stx|003 etx|004 eot|005 enq|006 ack|007 bel|
 | 
						||
" |008 bs |009 ht |010 nl |011 vt |012 np |013 cr |014 so |015 si |
 | 
						||
" |016 dle|017 dc1|018 dc2|019 dc3|020 dc4|021 nak|022 syn|023 etb|
 | 
						||
" |024 can|025 em |026 sub|027 esc|028 fs |029 gs |030 rs |031 us |
 | 
						||
" |032 sp |033  ! |034  " |035  # |036  $ |037  % |038  & |039  ' |
 | 
						||
" |040  ( |041  ) |042  * |043  + |044  , |045  - |046  . |047  / |
 | 
						||
" |048  0 |049  1 |050  2 |051  3 |052  4 |053  5 |054  6 |055  7 |
 | 
						||
" |056  8 |057  9 |058  : |059  ; |060  < |061  = |062  > |063  ? |
 | 
						||
" |064  @ |065  A |066  B |067  C |068  D |069  E |070  F |071  G |
 | 
						||
" |072  H |073  I |074  J |075  K |076  L |077  M |078  N |079  O |
 | 
						||
" |080  P |081  Q |082  R |083  S |084  T |085  U |086  V |087  W |
 | 
						||
" |088  X |089  Y |090  Z |091  [ |092  \ |093  ] |094  ^ |095  _ |
 | 
						||
" |096  ` |097  a |098  b |099  c |100  d |101  e |102  f |103  g |
 | 
						||
" |104  h |105  i |106  j |107  k |108  l |109  m |110  n |111  o |
 | 
						||
" |112  p |113  q |114  r |115  s |116  t |117  u |118  v |119  w |
 | 
						||
" |120  x |121  y |122  z |123  { |124  | |125  } |126  ~ |127 del|
 | 
						||
"
 | 
						||
" ===================================================================
 | 
						||
" ASCII Table - | hex value - name/char |
 | 
						||
"
 | 
						||
" | 00 nul| 01 soh| 02 stx| 03 etx| 04 eot| 05 enq| 06 ack| 07 bel|
 | 
						||
" | 08 bs | 09 ht | 0a nl | 0b vt | 0c np | 0d cr | 0e so | 0f si |
 | 
						||
" | 10 dle| 11 dc1| 12 dc2| 13 dc3| 14 dc4| 15 nak| 16 syn| 17 etb|
 | 
						||
" | 18 can| 19 em | 1a sub| 1b esc| 1c fs | 1d gs | 1e rs | 1f us |
 | 
						||
" | 20 sp | 21  ! | 22  " | 23  # | 24  $ | 25  % | 26  & | 27  ' |
 | 
						||
" | 28  ( | 29  ) | 2a  * | 2b  + | 2c  , | 2d  - | 2e  . | 2f  / |
 | 
						||
" | 30  0 | 31  1 | 32  2 | 33  3 | 34  4 | 35  5 | 36  6 | 37  7 |
 | 
						||
" | 38  8 | 39  9 | 3a  : | 3b  ; | 3c  < | 3d  = | 3e  > | 3f  ? |
 | 
						||
" | 40  @ | 41  A | 42  B | 43  C | 44  D | 45  E | 46  F | 47  G |
 | 
						||
" | 48  H | 49  I | 4a  J | 4b  K | 4c  L | 4d  M | 4e  N | 4f  O |
 | 
						||
" | 50  P | 51  Q | 52  R | 53  S | 54  T | 55  U | 56  V | 57  W |
 | 
						||
" | 58  X | 59  Y | 5a  Z | 5b  [ | 5c  \ | 5d  ] | 5e  ^ | 5f  _ |
 | 
						||
" | 60  ` | 61  a | 62  b | 63  c | 64  d | 65  e | 66  f | 67  g |
 | 
						||
" | 68  h | 69  i | 6a  j | 6b  k | 6c  l | 6d  m | 6e  n | 6f  o |
 | 
						||
" | 70  p | 71  q | 72  r | 73  s | 74  t | 75  u | 76  v | 77  w |
 | 
						||
" | 78  x | 79  y | 7a  z | 7b  { | 7c  | | 7d  } | 7e  ~ | 7f del|
 | 
						||
" ===================================================================
 | 
						||
"
 | 
						||
" ===================================================================
 | 
						||
" If your read this...
 | 
						||
" ===================================================================
 | 
						||
" ... then please send me an email!  Thanks!  --Sven guckes@vim.org
 | 
						||
" I have received some emails so far - thanks, folks!
 | 
						||
" Enjoy Vim!  :-)
 | 
						||
" ===================================================================
 | 
						||
" Yet another example for an autocommand:  [980616]
 | 
						||
  au VimLeave * echo "Thanks for using Vim"version". --Sven Guckes@vim.org!"
 | 
						||
" ===================================================================
 | 
						||
" Last but not least...
 | 
						||
" =====================================================
 | 
						||
" The last line is allowed to be a "modeline" with my setup.
 | 
						||
" It gives vim commands for setting variable values that are
 | 
						||
" specific for editing this file.  Used mostly for setting
 | 
						||
" the textwidth (tw) and the "shiftwidth" (sw).
 | 
						||
" Note that the colon within the value of "comments" needs to
 | 
						||
" be escaped with a backslash!  (Thanks, Thomas!)
 | 
						||
"       vim:tw=70 et sw=4 comments=\:\"
 |