* insexpand.c hard to read * tests: Test_log_nonexistent only works on Linux * Update base-syntax, improve variable matching * Vim9: import with extends may crash * leaking memory with completing multi lines * --log with non-existent path causes a crash * if_perl: Perl 5.38 adds new symbols causing link failure * tests: matchparen plugin test wrongly named * Vim9: problem finding implemented method in type hierarchy * runtime(qf): Update syntax file, match second delimiter * tests: output of test ...win32_ctrl_z depends on python version * tests: fix expected return code for python 3.13 on Windows * tests: timeout might be a bit too small * tests: test_terminwscroll_topline2 unreliable * tests: No check when tests are run under Github actions * tests: plugin tests are named inconsistently * Vim9: import with extends may crash * completion doesn't work with multi lines * filetype: cmmt files are not recognized * Unable to persistently ignore events in a window and its buffers * improve syntax highlighting * setreg() doesn't correctly handle mbyte chars in blockwise mode * unexpected DCS responses may cause out of bounds reads * has('bsd') is true for GNU/Hurd * filetype: Mill files are not recognized * GUI late startup leads to uninitialized scrollbars * Add support for lz4 to tar & gzip plugin * Terminal ansi colors off by one after tgc reset * included syntax items do not understand contains=TOP OBS-URL: https://build.opensuse.org/package/show/editors/vim?expand=0&rev=875
1531 lines
55 KiB
Plaintext
1531 lines
55 KiB
Plaintext
version 5.2
|
||
" ==================================================================
|
||
" File: $HOME/.vimrc
|
||
" Availability: This file is available as
|
||
" <URL:http://www.math.fu-berlin.de/~guckes/setup/vimrc>
|
||
" <URL:http://www.math.fu-berlin.de/~guckes/setup/vimrc.gz>
|
||
" <URL:http://www.vim.org/rc> (mirror)
|
||
" Purpose: Setup file for the editor Vim (Vi IMproved)
|
||
" Author: Sven Guckes guckes@vim.org (guckes@math.fu-berlin.de)
|
||
" <URL:http://www.math.fu-berlin.de/~guckes/sven/>
|
||
" Size: This file is about 56K in size and has 1,500+ lines.
|
||
" Related files:
|
||
" http://www.math.fu-berlin.de/~guckes/vim/src/latex.vim
|
||
" http://www.math.fu-berlin.de/~guckes/vim/src/html.vim
|
||
" http://www.math.fu-berlin.de/~guckes/vim/syntax/
|
||
" Note: Please send comments to me - email preferred! :-)
|
||
" Last update: Fri Aug 28 18:30:00 CEST 1998
|
||
" ===================================================================
|
||
" Latest versions of Vim according to my Vim signature:
|
||
" --
|
||
" Sven Guckes guckes@vim.org | Vim = Vi IMproved | versions
|
||
" FAQ http://www.vim.org/faq/ | for users: VIM-5.2 [980824]
|
||
" Users http://www.vim.org/user.html | developers: developing...
|
||
" Wishes http://www.vim.org/wish.html | Additions&Corrections welcome!
|
||
" ===================================================================
|
||
" Note to Windows users: Get these files from any Vim mirror:
|
||
" vim52rt.zip (840K)
|
||
" gvimw32.zip (440K)
|
||
" These should fit onto one floppy. Just a recommendation.
|
||
" ===================================================================
|
||
" Installation of this setup file:
|
||
"
|
||
" To use this setup file, copy it to
|
||
" this filename on these systems:
|
||
" ~/.vimrc Unix and OS/2
|
||
" s:.vimrc Amiga
|
||
" $VIM\_vimrc MS-DOS and Win32
|
||
"
|
||
" NOTE: This setup file uses a lot of features of Vim-5.
|
||
" If you are still using Vim-4 (or an even older version)
|
||
" then you should upgrade - it is really worth the effort!
|
||
" To find out why get Vim-5 and read ":help version5".
|
||
"
|
||
" The first line of this setup file contains the information
|
||
" "version xxx" which allows VIM to check whether the setup file
|
||
" fits the syntax that it understands.
|
||
" Versions of VIM other than of version 5 then will give a warning
|
||
" as they do not understand this setup file command - a feature:
|
||
" Give a warning so the user knows that there is something odd
|
||
" about the setup file.
|
||
" ===================================================================
|
||
" Whitespace meta sequence:
|
||
" vim-5.0s introduced the meta sequence "\s" which stands for "whitespace"
|
||
" ie either a space or a tab. This makes mappings a lot easier.
|
||
" I have therefore updated my mappings to use this sequence.
|
||
" But this is incompatible with previous versions and, of course, Vi.
|
||
" ===================================================================
|
||
" Info on the latest versions is on the Vim HomePage:
|
||
" http://www.vim.org/ - which is a daily mirror of the pages at
|
||
" http://www.math.fu-berlin.de/~guckes/vim/
|
||
" and in Sven's signature file:
|
||
" http://www.math.fu-berlin.de/~guckes/sig/SIGS
|
||
" ===================================================================
|
||
" ===================================================================
|
||
" Structure of this file:
|
||
" Lines starting with an inverted comma (") are comments.
|
||
" Some mappings are commented out. Remove the comment to enable them.
|
||
"
|
||
" There are three kinds of things which are defined in this file:
|
||
" Mapping ("map"), settings ("set"), and abbreviations ("ab").
|
||
" Settings affect the behaviour of commands.
|
||
" Mappings maps a key sequence to a command.
|
||
" Abbreviations define words which are replaced
|
||
" right *after* they are typed in.
|
||
"
|
||
" ===================================================================
|
||
" Note on mappings - "angle notation" (see ":help <>"):
|
||
" VIM allows you to define mappings with special characters
|
||
" with a notation that uses non-special characters:
|
||
" The notation encloses decriptive words in angle brackets (<>).
|
||
" The characters you will most often are:
|
||
" <C-M> for control-m
|
||
" <C-V> for control-v which quotes the following character
|
||
" <ESC> for the escape character.
|
||
" All control characters have been replaced to use the angle notation
|
||
" so you should be able to read this file without problems.
|
||
" (Well, sometimes I leave some tabs [control-i] in the file. ;-)
|
||
" ===================================================================
|
||
" External programs:
|
||
" Some mappings make use of external programs.
|
||
" The following you should find on every UNIX system:
|
||
" awk, egrep, grep, ispell, perl, sed.
|
||
" If you are using DOS then you should get these for you system!!
|
||
" Programs that are supplied with the mailer ELM: elmalias, readmsg.
|
||
" To get these look at page
|
||
" http://www.math.fu-berlin.de/~guckes/elm/dist.html
|
||
" One major advantage of vim-5 (actually, 5.0g) is that there is now
|
||
" the internal function "strftime". This allows to insert the current
|
||
" date and time in various format. Example: mapping ",L" (see below)
|
||
" ===================================================================
|
||
" SETtings
|
||
" ===================================================================
|
||
"
|
||
" autoindent: "off" as I usually do not write code.
|
||
set noautoindent
|
||
"
|
||
" autowrite: "on" saves a lot of trouble
|
||
set autowrite
|
||
"
|
||
" backup: backups are for wimps ;-)
|
||
set nobackup
|
||
"
|
||
" backspace: '2' is much smarter.
|
||
set backspace=2
|
||
"
|
||
" background: Are we using a "light" or "dark" background?
|
||
" set background=dark
|
||
"
|
||
" compatible ....
|
||
set nocompatible
|
||
"
|
||
" comments default: sr:/*,mb:*,el:*/,://,b:#,:%,:XCOMM,n:>,fb:-
|
||
set comments=b:#,:%,fb:-,n:>,n:)
|
||
"
|
||
" cpoptions you should get to know - source of many FAQs! ;-)
|
||
" cpoptions: "compatible options" to match Vi behaviour
|
||
" set cpoptions="aABceFs" "default!
|
||
" FAQ: Do NOT include the flag '<' if you WANT angle notation!
|
||
"
|
||
" dictionary: english words first
|
||
set dictionary=/usr/dict/words,/local/lib/german.words
|
||
"
|
||
" digraph: required for those umlauts
|
||
set digraph
|
||
"
|
||
" errorbells: damn this beep! ;-)
|
||
set noerrorbells
|
||
|
||
" esckeys: allow usage of cursor keys within insert mode
|
||
set esckeys
|
||
"
|
||
" formatoptions: Options for the "text format" command ("gq")
|
||
" I need all those options (but 'o')!
|
||
set formatoptions=cqrt
|
||
"
|
||
" helpheight: zero disables this.
|
||
set helpheight=0
|
||
"
|
||
" helpfile: filename of the helpfile
|
||
" set helpfile=c:\\vim-4.6\\docs\\help.txt
|
||
" this is where I usually put it on DOS; sometimes is required
|
||
" to set as the default installation does not find it :-(
|
||
"
|
||
" hidden:
|
||
set hidden
|
||
"
|
||
" highlight=8b,db,es,hs,mb,Mn,nu,rs,sr,tb,vr,ws
|
||
set highlight=8r,db,es,hs,mb,Mr,nu,rs,sr,tb,vr,ws
|
||
"
|
||
" hlsearch : highlight search - show the current search pattern
|
||
" This is a nice feature sometimes - but it sure can get in the
|
||
" way sometimes when you edit.
|
||
set nohlsearch
|
||
"
|
||
" icon: ...
|
||
set noicon
|
||
"
|
||
" set iconstring file of icon (Sven doesn't use an icon)
|
||
" set iconstring
|
||
"
|
||
" ignorecase: ignore the case in search patterns? NO!
|
||
set noignorecase
|
||
"
|
||
" insertmode: start in insert mode? Naah.
|
||
set noinsertmode
|
||
"
|
||
"
|
||
" iskeyword: Add the dash ('-'), the dot ('.'), and the '@'
|
||
" as "letters" to "words".
|
||
" iskeyword=@,48-57,_,192-255 (default)
|
||
set iskeyword=@,48-57,_,192-255,-,.,@-@
|
||
"
|
||
" joinspaces: insert two spaces after a period with every
|
||
" joining of lines. This is very nice!
|
||
set joinspaces
|
||
"
|
||
" keywordprg: Program to use for the "K" command.
|
||
" set keywordprg=man\ -s
|
||
"
|
||
" laststatus: show status line? Yes, always!
|
||
" laststatus: Even for only one buffer.
|
||
set laststatus=2
|
||
"
|
||
" [VIM5]lazyredraw: do not update screen while executing macros
|
||
set lazyredraw
|
||
"
|
||
" magic: use some magic in search patterns? Certainly!
|
||
set magic
|
||
"
|
||
" modeline: ...
|
||
" Allow the last line to be a modeline - useful when
|
||
" the last line in sig gives the preferred textwidth for replies.
|
||
set modeline
|
||
set modelines=1
|
||
"
|
||
" number: ...
|
||
set nonumber
|
||
"
|
||
" path: The list of directories to search when you specify
|
||
" a file with an edit command.
|
||
" Note: "~/.P" is a symlink to my dir with www pages
|
||
" "$VIMRUNTIME/syntax" is where the syntax files are.
|
||
set path=.,,~/.P/vim,~/.P/vim/syntax,~/.P/vim/source,$VIMRUNTIME/syntax/
|
||
" set path=.,,~/.P/vim,~/.P/mutt/,~/.P/elm,~/.P/slrn/,~/.P/nn
|
||
"
|
||
" report: show a report when N lines were changed.
|
||
" report=0 thus means "show all changes"!
|
||
set report=0
|
||
"
|
||
" ruler: show cursor position? Yep!
|
||
set ruler
|
||
"
|
||
" Setting the "shell" is always tricky - especially when you are
|
||
" trying to use the same vimrc on different operatin systems.
|
||
" shell for DOS
|
||
" set shell=command.com
|
||
" shell for UNIX - math.fu-berlin.de BSD
|
||
" set shell=zsh
|
||
" shell for UNIX - inf.fu-berlin.de BSD&Solaris
|
||
" set shell=zsh
|
||
" shell for UNIX - zedat.fu-berlin.de BSD&Solaris
|
||
" set shell=/bin/tcsh
|
||
" zsh now available at zedat! :-)
|
||
" set shell=zsh
|
||
" Now that vim-5 has ":if" I am trying to automate the setting:
|
||
"
|
||
if has("dos16") || has("dos32")
|
||
let shell='command.com'
|
||
endif
|
||
if has("unix")
|
||
let shell='zsh'
|
||
endif
|
||
"
|
||
" shiftwidth: Number of spaces to use for each
|
||
" insertion of (auto)indent.
|
||
set shiftwidth=8
|
||
"
|
||
" shortmess: Kind of messages to show. Abbreviate them all!
|
||
" New since vim-5.0v: flag 'I' to suppress "intro message".
|
||
set shortmess=at
|
||
"
|
||
" showcmd: Show current uncompleted command? Absolutely!
|
||
set showcmd
|
||
"
|
||
" showmatch: Show the matching bracket for the last ')'?
|
||
set showmatch
|
||
"
|
||
" showmode: Show the current mode? YEEEEEEEEESSSSSSSSSSS!
|
||
set showmode
|
||
"
|
||
" suffixes: Ignore filename with any of these suffixes
|
||
" when using the ":edit" command.
|
||
" Most of these are files created by LaTeX.
|
||
set suffixes=.aux,.bak,.dvi,.gz,.idx,.log,.ps,.swp,.tar
|
||
"
|
||
" startofline: no: do not jump to first character with page
|
||
" commands, ie keep the cursor in the current column.
|
||
set nostartofline
|
||
"
|
||
" tabstop
|
||
set tabstop=8
|
||
"
|
||
"
|
||
" Set the colors for vim on "xterm"
|
||
if &term=="xterm"
|
||
set t_Co=8 " "terminal has eight colors"
|
||
set t_Sb=[4%dm " escape sequence for background
|
||
set t_Sf=[3%dm " escape sequence for foreground
|
||
" source ~/.P/vim/syntax/colors.vim
|
||
" http://www.math.fu-berlin.de/~guckes/vim/syntax/colors.vim
|
||
" [todo] Add this to the Vim FAQ
|
||
endif
|
||
"
|
||
" textmode: no - I am using Vim on UNIX!
|
||
set notextmode
|
||
"
|
||
" textwidth
|
||
set textwidth=79
|
||
"
|
||
" title:
|
||
set notitle
|
||
"
|
||
" ttyfast: are we using a fast terminal?
|
||
" seting depends on where I use Vim...
|
||
set nottyfast
|
||
"
|
||
" ttybuiltin:
|
||
set nottybuiltin
|
||
"
|
||
" ttyscroll: turn off scrolling -> faster!
|
||
set ttyscroll=0
|
||
"
|
||
" ttytype:
|
||
" set ttytype=rxvt
|
||
"
|
||
" viminfo: What info to store from an editing session
|
||
" in the viminfo file; can be used at next session.
|
||
set viminfo=%,'50,\"100,:100,n~/.viminfo
|
||
"
|
||
" visualbell:
|
||
set visualbell
|
||
"
|
||
" t_vb: terminal's visual bell - turned off to make Vim quiet!
|
||
" Please use this as to not annoy cow-orkers in the same room.
|
||
" Thankyou! :-)
|
||
set t_vb=
|
||
"
|
||
" whichwrap:
|
||
set whichwrap=<,>
|
||
"
|
||
" wildchar the char used for "expansion" on the command line
|
||
" default value is "<C-E>" but I prefer the tab key:
|
||
set wildchar=<TAB>
|
||
"
|
||
" wrapmargin:
|
||
set wrapmargin=1
|
||
"
|
||
" writebackup:
|
||
set nowritebackup
|
||
"
|
||
" ===================================================================
|
||
" ABbreviations
|
||
" ===================================================================
|
||
" 980701: Moved the abbreviations *before* the mappings as
|
||
" some of the abbreviations get used with some mappings.
|
||
"
|
||
" Abbreviations for some important numbers:
|
||
iab Npi 3.1415926535897932384626433832795028841972
|
||
iab Ne 2.7182818284590452353602874713526624977573
|
||
"
|
||
" Abbreviations for some classic long words:
|
||
"
|
||
" Donau... is the German word for the (read in reverse)
|
||
" "additional paragraph of the law regulating the pension of
|
||
" widows to captains of the ship company on (the river) Danube"
|
||
" (I am not making this up! ;-)
|
||
iab YDD Donaudampfschiffahrtgesellschaftskapitaenwitwenrentengesetzzusatzparagraph
|
||
"
|
||
" YLL : The name of a town in Wales. I am not making this up!
|
||
iab YLL LLanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch
|
||
" http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.co.uk
|
||
" http://194.159.85.168/ - I am not making this up! :-)
|
||
"
|
||
" YTauma: The name of a hill in New Zealand.
|
||
iab YTauma Taumatawhakatangihangakoauauotamateaturipukakapikimaungahoronukupokaiwenuakitanatahu
|
||
"
|
||
" Yalpha : The lower letter alphabet.
|
||
iab Yalpha abcdefghijklmnopqrstuvwxyz
|
||
"
|
||
" YALPHA : The upper letter alphabet.
|
||
iab YALPHA ABCDEFGHIJKLMNOPQRSTUVWXYZ
|
||
"
|
||
" Ydigit : The ten digits.
|
||
iab Ydigit 1234567890
|
||
"
|
||
" Yruler : A ruler.
|
||
iab Yruler 1234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890
|
||
"
|
||
" Yupsidedown : This describes people from "down under"
|
||
" (Hi, Dean!).
|
||
iab Yupsidedown umop-ap!sdn
|
||
"
|
||
" Ysuper: A nice long word from the musical "Mary Poppins".
|
||
iab Ysuper supercalifragilisticexpialidocious
|
||
|
||
" Yanti: The longest proper word in the English language?!
|
||
iab Yanti antidisestablishmentarianism
|
||
"
|
||
" Ypass : Standard answer to Usenet posts
|
||
" with the "Subject: HELP" (hehe)
|
||
iab Ypass "You are in a maze of twisty little passages, all alike."
|
||
"
|
||
" Ysesqui : "Sesquipedalophobia" means "fear of big words." ;-)
|
||
iab Ysesqui sesquipedalophobia
|
||
"
|
||
" classic pangrams (which include every letter of the alphabet):
|
||
" German:
|
||
" sylvia wagt quick den jux bei pforzheim
|
||
" bayerische jagdwitze von maxl querkopf
|
||
" zwei boxkaempfer jagen eva quer durch sylt
|
||
" kaufen sie jede woche vier gute bequeme pelze
|
||
" falsches <20>ben von xylophonmusik qu<71>lt jeden gr<67><72>eren zwerg.
|
||
" Bei jedem klugen Wort von Sokrates rief Xanthippe zynisch: Quatsch!
|
||
" English:
|
||
" the quick brown fox jumps over the lazy dog
|
||
" French:
|
||
" voyez le brick geant que j'examine pres du wharf.
|
||
"
|
||
" And a sentence to break some quoing levels:
|
||
" "This man's house (which 's yellow) burned down."
|
||
"
|
||
" And now for something completely different:
|
||
" I couldn't bear to bear bears over the border.
|
||
"
|
||
" Inserting an ellipsis to indicate deleted text
|
||
iab Yell [...]
|
||
vmap ,ell c[...]<ESC>
|
||
"
|
||
" Correcting those typos. [I almost never get these right. :-(]
|
||
" See also: http://www.igd.fhg.de/~zach/programs/acl/
|
||
iab alos also
|
||
iab aslo also
|
||
iab charcter character
|
||
iab charcters characters
|
||
iab exmaple example
|
||
iab shoudl should
|
||
iab seperate separate
|
||
iab teh the
|
||
" Some frequent typos in German:
|
||
iab nciht nicht
|
||
iab doer oder
|
||
iab Dreckfuhler Druckfehler
|
||
" Sorry, Laurent!
|
||
iab Laurant Laurent
|
||
"
|
||
" See http://www.math.fu-berlin.de/~guckes/sig/:
|
||
iab YDDS dash-dash-space
|
||
"
|
||
" For reports and texts on my studies:
|
||
iab YKT Komplexitaetstheorie
|
||
iab YRA Rechnerarchitektur
|
||
iab YPM Pattern Matching
|
||
" see http://elib.zib.de/ICM98 :
|
||
iab YICM International Congress of Mathematicians
|
||
"
|
||
" Some sentences that I really use often in emails about Vim:
|
||
iab YAW You are welcome! :-)
|
||
iab YEV Enjoy Vim!
|
||
"
|
||
" Often used filenames - only needed these on the command line:
|
||
" see also: http://www.math.fu-berlin.de/~guckes/setup/
|
||
"
|
||
cab ELMALIAS ~/.elm/aliases.text
|
||
cab Erc ~/.elm/elmrc
|
||
cab Mrc ~/.muttrc
|
||
cab Src ~/.slrnrc
|
||
cab Zrc ~/.zsh/.zshrc
|
||
cab SIGs ~/.P/sig/SIGS
|
||
"
|
||
" A list of filenames that are needed to shorten some autocommands:
|
||
" cab MAILNEWSFILES .article,.followup,.letter,mutt*[0-9],/postpone/*
|
||
" cab MAILNEWSFILES *.article,*.followup,*.letter,*mutt*
|
||
let MAILNEWSFILES = "*.article,*.followup,*.letter,mutt*"
|
||
"
|
||
" see also: http://www.math.fu-berlin.de/~guckes/sig/SIGS
|
||
"
|
||
" Email Adresses:
|
||
" I usually use these when adding addresses to the header
|
||
" of emails (mutt) and posts (slrn).
|
||
"
|
||
" Author of the Good NetKeeping Seal of Approval:
|
||
ab Agnksa js@xs4all.nl (Jeroen Scheerder)
|
||
"
|
||
" Author of Mutt:
|
||
ab Amutt me@cs.hmc.edu (Michael Elkins)
|
||
"
|
||
" Author of Slrn:
|
||
ab Aslrn davis@space.mit.edu (John E. Davis)
|
||
"
|
||
" Author of Vim:
|
||
" ab Avim mool@oce.nl (Bram Moolenaar)
|
||
ab Avim bram@vim.org (Bram Moolenaar)
|
||
"
|
||
" Former Maintainer of the Vim FAQ:
|
||
ab Avimfaq laurent@Grafnetix.COM (Laurent Duperval)
|
||
"
|
||
" Mailing Lists (MLs)
|
||
"
|
||
" The Vim mailing lists: See http://www.vim.org/mail.html for more info!
|
||
ab MLvim vim@vim.org (VIM Help List)
|
||
ab MLvimdev vim-dev@vim.org (VIM Development List)
|
||
ab MLvimmac guckes-vimmac@math.fu-berlin.de (VIM on MacOS Development List)
|
||
"
|
||
" More mailing lists:
|
||
ab MLgnksa gnksa-workers@babayaga.math.fu-berlin.de (GNKSA Workers List)
|
||
ab MLmuttdev mutt-dev@mutt.org (Mutt Developer List)
|
||
ab MLmuttuser mutt-users@mutt.org (Mutt USers List)
|
||
ab MLzsh zsh-users@math.gatech.edu (ZShell Users List)
|
||
"
|
||
"
|
||
" News: newsgroup names
|
||
"
|
||
" Newsgroup about "warloding" of signatures - see
|
||
" also http://www.math.fu-berlin.de/~guckes/afw/
|
||
iab Nafw alt.fan.warlord
|
||
iab Nahbou alt.humor.best-of-usenet
|
||
iab Nzedat bln.announce.fub.zedat.d
|
||
iab Ncsd bln.announce.fub.cs.d
|
||
iab Nce comp.editors
|
||
" Newsgroup about "lynx":
|
||
iab Nhtml comp.infosystems.www.authoring.html
|
||
" Newsgroup about "elm": Elm is dead - long live Mutt!
|
||
iab Nelm comp.mail.elm
|
||
" Newsgroup about "pine": When will they release pine-4?
|
||
" iab Ncmp comp.mail.pine
|
||
iab Npine comp.mail.pine
|
||
" iab Ncsmd comp.sys.mac.digest
|
||
" Newsgroup about "mobil phone systems":
|
||
iab Ndcm de.comm.mobil
|
||
iab Nmobil de.comm.mobil
|
||
" Newsgroup about "web browsers":
|
||
iab Nlynx comp.infosystems.www.browsers.misc
|
||
iab Nnetscape comp.infosystems.www.browsers.misc
|
||
" Newsgroup about "mutt" [since 980401]: The coolest mail user agent
|
||
iab Nmutt comp.mail.mutt
|
||
" Newsgroup about "nn": Once was the best newsreader. Still good.
|
||
iab Nnn news.software.nn
|
||
" Newsgroup for "newbies".
|
||
" All you ever wanted to know - but were afraid to ask. ;-)
|
||
iab Newbie news.newusers.questions
|
||
" Newsgroup about "newsreader *agents*" (netscape and slrn):
|
||
iab Nnsr news.software.readers
|
||
"
|
||
" Usenet header lines (used when composing a post):
|
||
"
|
||
iab UFT Followup-To:
|
||
iab UMCT Mail-Copies-To: MYADDR
|
||
iab UNG Newsgroups:
|
||
iab URT Reply-To: MYADDR
|
||
iab UFUB Organization: Freie Universitaet Berlin
|
||
"
|
||
" Current version numbers of my favourite programs:
|
||
" http://www.math.fu-berlin.de/~guckes/sig/SIGS
|
||
" And some abbreviations to type them in mail&news:
|
||
"
|
||
iab Velm ELM2.4PL25 [951204]
|
||
iab VElm ELM2.5b2 [980213]
|
||
iab Vlynx lynx-2.8.0 [980310
|
||
iab Vmutt mutt-0.92.8 [980514]
|
||
iab Vslrn slrn-0.9.5.2 [980503]
|
||
iab Vvim vim-5.1 [980407]
|
||
iab Vvimdev vim-5.2c [980518]
|
||
"
|
||
" For current version numbers take a look at my signature file:
|
||
" http://www.math.fu-berlin.de/~guckes/sig/SIGS
|
||
"
|
||
" My snail mail address, phone numbers, and email->pager gateway:
|
||
" Postcards and FAXes are welcome (especially with cartoons :-).
|
||
" If you want, you can send a message to my pager by email, too.
|
||
iab Ypager To: ums@teco.edu<C-M>Subject: PAGE:01777777796
|
||
iab Yphone TEL/FAX (+49 30) 8838884<C-M>Cellphone (+49 177) 7777796
|
||
iab Ysnail Sven Guckes<C-M>Pariser Str. 52<C-M>D-10719 Berlin
|
||
"
|
||
" My addresses (Email and WWW)
|
||
"
|
||
ab Amaili guckes@inf.fu-berlin.de
|
||
ab Amailm guckes@math.fu-berlin.de
|
||
ab Amailv guckes@vim.org
|
||
ab Amailz guckes@zedat.fu-berlin.de
|
||
ab MYADDR guckes@math.fu-berlin.de
|
||
"
|
||
" Setting the reply address when replying as the guy from SKB:
|
||
ab ASKB Sprachboerse <sprachboerse@tu-berlin.de>
|
||
" See also: http://www.math.fu-berlin.de/~guckes/skb/
|
||
"
|
||
" My Home Pages at the departments at the FUB
|
||
"
|
||
ab WWWm http://www.math.fu-berlin.de/~guckes/
|
||
ab WWWi http://www.inf.fu-berlin.de/~guckes/
|
||
ab WWWz http://userpage.zedat.fu-berlin.de/~guckes/
|
||
"
|
||
" WWW Pages base URLs
|
||
"
|
||
ab HPA http://www.math.fu-berlin.de/~guckes/afw/
|
||
ab HPa http://www.math.fu-berlin.de/~guckes/ascii/
|
||
ab HPc http://www.math.fu-berlin.de/~guckes/calvin/
|
||
ab HPD http://www.math.fu-berlin.de/~guckes/dos/
|
||
ab HPe http://www.math.fu-berlin.de/~guckes/eplus/ab.faq.html
|
||
ab HPE http://www.math.fu-berlin.de/~guckes/elm/
|
||
ab HPI http://www.math.fu-berlin.de/~guckes/irc/
|
||
ab HPi http://www.math.fu-berlin.de/~guckes/ispell/
|
||
ab HPL http://www.math.fu-berlin.de/~guckes/lynx/
|
||
ab HPl http://www.math.fu-berlin.de/~guckes/less/
|
||
ab HPm http://www.math.fu-berlin.de/~guckes/mail/
|
||
ab HPM http://www.math.fu-berlin.de/~guckes/mutt/
|
||
ab HPN http://www.math.fu-berlin.de/~guckes/nn/
|
||
ab HPP http://www.math.fu-berlin.de/~guckes/pine/
|
||
ab HPp http://www.math.fu-berlin.de/~guckes/procmail/
|
||
ab HPr http://babayaga.math.fu-berlin.de/~rxvt/
|
||
ab HPR http://www.math.fu-berlin.de/~guckes/rfc/
|
||
ab HPs http://www.math.fu-berlin.de/~guckes/screen/
|
||
ab HPS http://www.math.fu-berlin.de/~guckes/slrn/
|
||
ab HPv http://www.math.fu-berlin.de/~guckes/vi/
|
||
" HPoV - "original" URL of the Vim Home Page
|
||
ab HPoV http://www.math.fu-berlin.de/~guckes/vim/
|
||
ab HPV http://www.vim.org/
|
||
ab HPX http://www.math.fu-berlin.de/~guckes/xmas/
|
||
ab HPZ http://www.math.fu-berlin.de/~guckes/zsh/
|
||
"
|
||
" Other important WWW addresses
|
||
"
|
||
ab URLutefuchs http://www.math.fu-berlin.de/~utefuchs/
|
||
ab URLaltavista http://altavista.digital.com/
|
||
ab URLftpsearch http://ftpsearch.ntnu.no/ftpsearch/
|
||
ab URLvimfaq http://www.grafnetix.com/~laurent/vim/faq.html
|
||
ab URLbambi http://www.math.fu-berlin.de/~leitner/CnH/bambi.html
|
||
ab URLsecret http://www.math.fu-berlin.de/~leitner/CnH/secret.html
|
||
ab URLwhome http://www.math.fu-berlin.de/~leitner/CnH/who.me.html
|
||
ab URLstopspam http://www.math.fu-berlin.de/~guckes/pics/stop.this.spam.jpg
|
||
ab FTPFUB ftp://ftp.fu-berlin.de/
|
||
ab FTPVIM ftp://ftp.fu-berlin.de/pub/misc/editors/vim/
|
||
"
|
||
" ===================================================================
|
||
" Abbreviations - Header Lines for Email and News
|
||
" ===================================================================
|
||
" Define regexpr for headers to use with mappings
|
||
" as it makes reading the mappings much easier:
|
||
" cab HADDR From\\|Cc\\|To
|
||
cab HEMAIL ^\(From\\|Cc\\|To\\|Date\\|Subject\\|Message-ID\\|Message-Id\\|X-\)
|
||
cab HNEWS ^\(From\\|Cc\\|To\\|Date\\|Subject\\|Message-ID\\|X-\\|Newsgroups\)
|
||
"
|
||
" ===================================================================
|
||
" Abbreviations - General Editing - Inserting Dates and Times
|
||
" ===================================================================
|
||
"
|
||
" First, some command to add date stamps (with and without time).
|
||
" I use these manually after a substantial change to a webpage.
|
||
" [These abbreviations are used with the mapping for ",L".]
|
||
"
|
||
iab Ydate <C-R>=strftime("%y%m%d")<CR>
|
||
" Example: 971027
|
||
"
|
||
iab Ytime <C-R>=strftime("%H:%M")<CR>
|
||
" Example: 14:28
|
||
"
|
||
iab YDT <C-R>=strftime("%y%m%d %T")<CR>
|
||
" Example: 971027 12:00:00
|
||
"
|
||
iab YDATE <C-R>=strftime("%a %b %d %T %Z %Y")<CR>
|
||
" Example: Tue Dec 16 12:07:00 CET 1997
|
||
"
|
||
" On Windows the functions "strftime" seems to have a different
|
||
" format. Therefore the following may be necessary: [980730]
|
||
" if !has("unix")
|
||
" iab YDATE <C-R>=strftime("%c %a")<CR>
|
||
" else
|
||
" iab YDATE <C-R>=strftime("%D %T %a")<CR>
|
||
" endif
|
||
"
|
||
" ===================================================================
|
||
" MAPpings
|
||
" ===================================================================
|
||
" Caveat: Mapping must be "prefix free", ie no mapping must be the
|
||
" prefix of any other mapping. Example: "map ,abc foo" and
|
||
" "map ,abcd bar" will give you the error message "Ambigous mapping".
|
||
"
|
||
" The backslash ('\') is the only(?) unmapped key, so this is the best
|
||
" key to start mappings with as this does not take away a command key.
|
||
" However, the backslash is never in the same position with keyboards.
|
||
" Eg on German keyboards it is AltGr-sz - don't ask.
|
||
" Anyway, I have decided to start mappings with the comma as this
|
||
" character is always on the same position on almost all keyboards
|
||
" and I hardly have a need for that command.
|
||
"
|
||
" The following maps get rid of some basic problems:
|
||
"
|
||
" With Vim-4 the format command was just 'Q' and
|
||
" I am too used to it. So I need this back!
|
||
nnoremap Q gq
|
||
vnoremap Q gq
|
||
"
|
||
" 980527 I often reformat a paragraph to fit some textwidth -
|
||
" and I use the following mapping to adjust it to the
|
||
" current position of the cursor:
|
||
map #tw :set textwidth=<C-R>=col(".")<C-M>
|
||
"
|
||
" "tal" is the "trailer alignment" filter program
|
||
" Hopefully it will ship with Vim one day.
|
||
" vmap #t !tal<CR>
|
||
" vmap #t !tal -p 0<CR>
|
||
"
|
||
" Disable the command 'K' (keyword lookup) by mapping it
|
||
" to an "empty command". (thanks, Lawrence! :-):
|
||
" map K :<CR>
|
||
map K :<BS>
|
||
"
|
||
" Disable the suspend for ^Z.
|
||
" I use Vim under "screen" where a suspend would lose the
|
||
" connection to the " terminal - which is what I want to avoid.
|
||
map <C-Z> :shell
|
||
"
|
||
" Make CTRL-^ rebound to the *column* in the previous file
|
||
noremap <C-^> <C-^>`"
|
||
"
|
||
" Make "gf" rebound to last cursor position (line *and* column)
|
||
noremap gf gf`"
|
||
"
|
||
" When I let Vim write the current buffer I frequently mistype the
|
||
" command ":w" as ":W" - so I have to remap it to correct this typo:
|
||
nmap :W :w
|
||
"
|
||
" Are you used to the Unix commands "alias" and "which"?
|
||
" I sometimes use these to look up my abbreviations and mappings.
|
||
" So I need them available on the command line:
|
||
map :alias map
|
||
map :which map
|
||
"
|
||
" The command {number}CTRL-G show the current nuffer number, too.
|
||
" This is yet another feature that vi does not have.
|
||
" As I always want to see the buffer number I map it to CTRL-G.
|
||
" Pleae note that here we need to prevent a loop in the mapping by
|
||
" using the comamnd "noremap"!
|
||
noremap <C-G> 2<C-G>
|
||
"
|
||
" 980311 Sourcing syntax files
|
||
" My personal syntax files are in ~/.P/vim/syntax/
|
||
" and I need a quick way to edit and source them.
|
||
map ,SO :so ~/.P/vim/syntax/
|
||
"
|
||
" 980706 Sourcing syntax files from the distribution
|
||
" A nice and fast way to both source syntax files
|
||
" and to take a look at "what's there":
|
||
map ,V :so $VIMRUNTIME/syntax/
|
||
"
|
||
" ===================================================================
|
||
" Customizing the command line
|
||
" ===================================================================
|
||
" Valid names for keys are: <Up> <Down> <Left> <Right> <Home> <End>
|
||
" <S-Left> <S-Right> <S-Up> <PageUp> <S-Down> <PageDown> <LeftMouse>
|
||
"
|
||
" Many shells allow editing in "Emacs Style".
|
||
" Although I love Vi, I am quite used to this kind of editing now.
|
||
" So here it is - command line editing commands in emacs style:
|
||
cnoremap <C-A> <Home>
|
||
cnoremap <C-F> <Right>
|
||
cnoremap <C-B> <Left>
|
||
cnoremap <ESC>b <S-Left>
|
||
cnoremap <ESC>f <S-Right>
|
||
cnoremap <ESC><C-H> <C-W>
|
||
"
|
||
" Additional codes for that "English" keyboard at the Xterminal
|
||
cnoremap <ESC>[D <S-Left>
|
||
cnoremap <ESC>[C <S-Right>
|
||
"
|
||
" Some editing is helpful in insert mode, too:
|
||
inoremap <C-F> <Right>
|
||
inoremap <C-B> <Left>
|
||
"
|
||
" Make the up and down movements move by "display/screen lines":
|
||
" map j gj
|
||
" map <Down> gj
|
||
" map k gk
|
||
" map <Up> gk
|
||
"
|
||
" ===================================================================
|
||
" VIM - Editing and updating the vimrc:
|
||
" As I often make changes to this file I use these commands
|
||
" to start editing it and also update it:
|
||
if has("unix")
|
||
let vimrc='~/.vimrc'
|
||
else
|
||
" ie: if has("dos16") || has("dos32") || has("win32")
|
||
let vimrc='$VIM\_vimrc'
|
||
endif
|
||
nn ,u :source <C-R>=vimrc<CR><CR>
|
||
nn ,v :edit <C-R>=vimrc<CR><CR>
|
||
" ,v = vimrc editing (edit this file)
|
||
" map ,v :e ~/.vimrc<CR>
|
||
" ,u = "update" by reading this file
|
||
" map ,u :source ~/.vimrc<CR>
|
||
" ===================================================================
|
||
"
|
||
" General Editing
|
||
"
|
||
" Define "del" char to be the same backspace (saves a LOT of trouble!)
|
||
" As the angle notation cannot be use with the LeftHandSide
|
||
" with mappings you must type this in *literally*!
|
||
" map <C-V>127 <C-H>
|
||
"cmap <C-V>127 <C-H>
|
||
"
|
||
" ;rcm = remove "control-m"s - for those mails sent from DOS:
|
||
cmap ;rcm %s/<C-M>//g
|
||
"
|
||
" Make whitespace visible:
|
||
" Sws = show whitespace
|
||
nmap ,Sws :%s/ /_/g<C-M>
|
||
vmap ,Sws :%s/ /_/g<C-M>
|
||
"
|
||
" Sometimes you just want to *see* that trailing whitespace:
|
||
" Stws = show trailing whitespace
|
||
nmap ,Stws :%s/ *$/_/g<C-M>
|
||
vmap ,Stws :%s/ *$/_/g<C-M>
|
||
"
|
||
" General Editing - Turning umlauts into ascii (for German keyboards)
|
||
"
|
||
" imap <20> ae
|
||
" imap <20> oe
|
||
" imap <20> ue
|
||
" imap <20> ss
|
||
"
|
||
" Ä -> <20> :%s/\Ä/<2F>/gc -> D
|
||
" Ö -> <20> :%s/\Ö/<2F>/gc -> V
|
||
" Ü -> <20> :%s/\Ü/<2F>/gc -> \
|
||
" ä -> <20> :%s/\ä/<2F>/gc -> d
|
||
" ö -> <20> :%s/\ö/<2F>/gc -> v
|
||
" ü -> <20> :%s/\ü/<2F>/gc -> |
|
||
"
|
||
" ===================================================================
|
||
" Inserting Dates and Times / Updating Date+Time Stamps
|
||
" ===================================================================
|
||
" ,L = "Last updated" - replace old time stamp with a new one
|
||
" preserving whitespace and using internal "strftime" command:
|
||
" requires the abbreviation "YDATE"
|
||
map ,L 1G/Last update:\s*/e+1<CR>CYDATE<ESC>
|
||
map ,,L 1G/Last change:\s*/e+1<CR>CYDATE<ESC>
|
||
" Example:
|
||
" before: "Last update: Thu Apr 6 12:07:00 CET 1967"
|
||
" after: "Last update: Tue Dec 16 12:07:00 CET 1997"
|
||
"
|
||
" ,L = "Last updated" - replace old time stamp with a new one
|
||
" using external "date" command (not good for all systems):
|
||
" map ,L 1G/Last update: */e+1<CR>D:r!date<CR>kJ
|
||
"
|
||
" ===================================================================
|
||
" General Editing - link to program "screen"
|
||
" ===================================================================
|
||
"
|
||
" ,Et = edit temporary file of "screen" program
|
||
map ,Et :e /tmp/screen-exchange
|
||
" as a user of Unix systems you *must* have this program!
|
||
" see also: http://www.math.fu-berlin.de/~guckes/screen/
|
||
"
|
||
" Email/News - Editing replies/followups
|
||
"
|
||
" Part 1 - prepare for editing
|
||
"
|
||
" Part 2 - getting rid of empty (quoted) lines and space runs.
|
||
"
|
||
" ,cel = "clear empty lines"
|
||
" - delete contents of all lines which contain only whitespace.
|
||
" map ,cel :g/^[<C-I> ]*$/d
|
||
map ,cel :%s/^\s\+$//
|
||
" ,del = "delete 'empty' lines"
|
||
" - delete all lines which contain only whitespace
|
||
" note: this does *not* delete empty lines!
|
||
map ,del :g/^\s\+$/d
|
||
"
|
||
" ,cqel = "clear quoted empty lines"
|
||
" Clears (makes empty) all lines which start with '>'
|
||
" and any amount of following spaces.
|
||
" nmap ,cqel :%s/^[> ]*$//
|
||
" vmap ,cqel :s/^[> ]*$//
|
||
nmap ,cqel :%s/^[><C-I> ]\+$//
|
||
vmap ,cqel :s/^[><C-I> ]\+$//
|
||
" The following do not work as "\s" is not a character
|
||
" and thus cannot be part of a "character set".
|
||
" nmap ,cqel :%s/^[>\s]\+$//
|
||
" vmap ,cqel :s/^[>\s]\+$//
|
||
"
|
||
" Some people have strange habits within their writing.
|
||
" But if you cannot educate them - rewrite their text! ;-)
|
||
"
|
||
" Jason "triple-dots" King elephant@onaustralia.com.au
|
||
" does uses ".." or "..." rather than the usual punctuation
|
||
" (comma, semicolon, colon, full stop). So...
|
||
"
|
||
" Turning dot runs with following spaces into an end-of-sentence,
|
||
" ie dot-space-space:
|
||
vmap ,dot :s/\.\+ \+/. /g
|
||
"
|
||
" Gary Kline (kline@tera.tera.com) indents his
|
||
" own text in replies with TAB or spaces.
|
||
" Here's how to get rid of these indentation:
|
||
vmap ,gary :s/^>[ <C-I>]\+\([^>]\)/> \1/
|
||
"
|
||
" ,ksr = "kill space runs"
|
||
" substitutes runs of two or more space to a single space:
|
||
" nmap ,ksr :%s/ */ /g
|
||
" vmap ,ksr :s/ */ /g
|
||
nmap ,ksr :%s/ \+/ /g
|
||
vmap ,ksr :s/ \+/ /g
|
||
" Why can't the removal of space runs be
|
||
" an option of "text formatting"? *hrmpf*
|
||
"
|
||
" ,Sl = "squeeze lines"
|
||
" Turn all blocks of empty lines (within current visual)
|
||
" into *one* empty line:
|
||
map ,Sl :g/^$/,/./-j
|
||
"
|
||
" ===================================================================
|
||
" Editing of email replies and Usenet followups - using autocommands
|
||
" ===================================================================
|
||
"
|
||
" Remove ALL auto-commands. This avoids having the
|
||
" autocommands twice when the vimrc file is sourced again.
|
||
autocmd!
|
||
"
|
||
" set the textwidth to 70 characters for replies (email&usenet)
|
||
au BufRead .letter,mutt*,nn.*,snd.* set tw=78
|
||
"
|
||
" Try to use the mapping ",D" when doing a followup.
|
||
" autocmd BufNewFile ~/.followup ,D|
|
||
"
|
||
" Part 3 - Change Quoting Level
|
||
"
|
||
" ,dp = de-quote current inner paragraph
|
||
" map ,dp {jma}kmb:'a,'bs/^> //<CR>
|
||
map ,dp vip:s/^> //<CR>
|
||
vmap ,dp :s/^> //<CR>
|
||
"
|
||
" ,qp = quote current paragraph
|
||
" jump to first inner line, mark with 'a';
|
||
" jump to last inner line, mark with 'b';
|
||
" then do the quoting as a substitution
|
||
" on the line range "'a,'b":
|
||
" map ,qp {jma}kmb:'a,'bs/^/> /<CR>
|
||
" vim-5 now has selection of "inner" and "all"
|
||
" of current text object - mapping commented!
|
||
"
|
||
" ,qp = quote current paragraph (old version)
|
||
" jump to first inner line, Visual,
|
||
" jump to last inner line,
|
||
" then do the quoting as a substitution:
|
||
" map ,qp {jV}k:s/^/> /<CR>
|
||
"
|
||
" ,qp = quote current inner paragraph (works since vim-5.0q)
|
||
" select inner paragraph
|
||
" then do the quoting as a substitution:
|
||
map ,qp vip:s/^/> /<CR>
|
||
"
|
||
" ,qp = quote current paragraph
|
||
" just do the quoting as a substitution:
|
||
vmap ,qp :s/^/> /<CR>
|
||
|
||
"
|
||
" Changing quote style to *the* true quote prefix string "> ":
|
||
"
|
||
" Fix Supercite aka PowerQuote (Hi, Andi! :-):
|
||
" before ,kpq: > Sven> text
|
||
" after ,kpq: > > text
|
||
" ,kpq kill power quote
|
||
vmap ,kpq :s/^> *[a-zA-Z]*>/> >/<C-M>
|
||
"
|
||
" Fix various other quote characters:
|
||
" ,fq "fix quoting"
|
||
vmap ,fq :s/^> \([-":}\|][ <C-I>]\)/> > /
|
||
"
|
||
" Part 4 - Weed Headers of quoted mail/post
|
||
"
|
||
" These mappings make use of the abbreviation that define a list of
|
||
" Email headers (HEMAIL) and News headers (HNEWS):
|
||
nmap ,we vip:v/HEMAIL/d
|
||
vmap ,we :v/HEMAIL/d
|
||
nmap ,wp vip:v/HNEWS/d
|
||
vmap ,wp :v/HNEWS/d
|
||
"
|
||
" Old versions for vim-4.6:
|
||
" ,we = "weed email header"
|
||
" nmap ,we !ipegrep "^(Date:\|From \|From:\|Subject:\|To:\|$)"
|
||
" vmap ,we !egrep "^(Date:\|From \|From:\|Subject:\|To:\|$)"
|
||
" ,wp = "weed post header"
|
||
" nmap ,wp !ipegrep "^(Date:\|From:\|Subject:\|Newsgroups:\|Followup-To:\|Keywords:\|References:\|Message-ID\|$)"
|
||
" vmap ,wp !egrep "^(Date:\|From:\|Subject:\|Newsgroups:\|Followup-To:\|Keywords:\|References:\|Message-ID\|$)"
|
||
"
|
||
" ,ri = "Read in" basic lines from the email header
|
||
" Useful when replying to an email:
|
||
" nmap ,ri :r!readmsg\|egrep "^From:\|^Subject:\|^Date:\|^To: \|^Cc:"
|
||
" NOTE: "readmsg" ships with the mailer ELM.
|
||
"
|
||
"
|
||
" Part 5 - Reformatting Text
|
||
"
|
||
" NOTE: The following mapping require formatoptions to include 'r'
|
||
" and "comments" to include "n:>" (ie "nested" comments with '>').
|
||
"
|
||
" ,b = break line in commented text (to be used on a space)
|
||
" nmap ,b dwi<CR>> <ESC>
|
||
nmap ,b r<CR>
|
||
" ,j = join line in commented text
|
||
" (can be used anywhere on the line)
|
||
" nmap ,j Jxx
|
||
nmap ,j Vjgq
|
||
"
|
||
" ,B = break line at current position *and* join the next line
|
||
" nmap ,B i<CR>><ESC>Jxx
|
||
nmap ,B r<CR>Vjgq
|
||
"
|
||
" ,,, break current line at current column,
|
||
" inserting ellipsis and "filling space":
|
||
nmap ,,, ,,1,,2
|
||
nmap ,,1 a...X...<ESC>FXr<CR>lmaky$o<CC-R>"<ESC>
|
||
nmap ,,2 :s/./ /g<C-M>3X0"yy$dd`a"yP
|
||
"
|
||
"
|
||
" ===================================================================
|
||
" Edit your reply! (Or else!)
|
||
" ===================================================================
|
||
"
|
||
" Part 6 - Inserting Special or Standard Text
|
||
" Part 6a - The header
|
||
|
||
" Add adresses for To: and Cc: lines
|
||
"
|
||
" ,ca = check alias (reads in expansion of alias name)
|
||
" map ,ca :r!elmalias -f "\%v (\%n)"
|
||
" ,Ca = check alias (reads in expansion of alias name)
|
||
" map ,Ca :r!elmalias -f "\%n <\%v>"
|
||
"
|
||
" ,cc = "copy notice"
|
||
" Insert a Cc line so that person will receive a "courtesy copy";
|
||
" this tells the addressee that text is a copy of a public article.
|
||
" This assumes that there is exactly one empty line after the first
|
||
" paragraph and the first line of the second paragraph contains the
|
||
" return address with a trailing colon (which is later removed).
|
||
map ,cc 1G}jyykPICc: <ESC>$x
|
||
" map ,cc ma1G}jy/ writes<CR>'aoCc: <ESC>$p
|
||
"
|
||
" ,mlu = make letter urgent (by giving the "Priority: urgent")
|
||
map ,mlu 1G}OPriority: urgent<ESC>
|
||
"
|
||
" Fixing the From: line
|
||
"
|
||
" ,cS = change Sven's address.
|
||
map ,cS 1G/^From: Sven Guckes/e+2<CR>C<Amailv><ESC>
|
||
" Used when replying as the "guy from vim".
|
||
"
|
||
" Fixing the Subject line
|
||
"
|
||
" Pet peeve: Unmeaningful Subject lines. Change them!
|
||
" ,cs = change Subject: line
|
||
map ,cs 1G/^Subject: <CR>yypIX-Old-<ESC>-W
|
||
" This command keeps the old Subject line in "X-Old-Subject:" -
|
||
" so the recipient can still search for it and
|
||
" you keep a copy for editing.
|
||
"
|
||
"
|
||
" ,re : Condense multiple "Re:_" to just one "Re:":
|
||
map ,re 1G/^Sub<CR>:s/\(Re: \)\+/Re: /<CR>
|
||
"
|
||
" ,Re : Change "Re: Re[n]" to "Re[n+1]" in Subject lines:
|
||
map ,Re 1G/^Subject: <C-M>:s/Re: Re\[\([0-9]\+\)\]/Re[\1]/<C-M><C-A>
|
||
"
|
||
" Put parentheses around "visual text"
|
||
" Used when commenting out an old subject.
|
||
" Example:
|
||
" Subject: help
|
||
" Subject: vim - using autoindent (Re: help)
|
||
"
|
||
" ,) and ,( :
|
||
vmap ,( v`<i(<ESC>`>a)<ESC>
|
||
vmap ,) v`<i(<ESC>`>a)<ESC>
|
||
"
|
||
" Part 6 - Inserting Special or Standard Text
|
||
" Part 6a - Start of text - saying "hello".
|
||
"
|
||
" ,hi = "Hi!" (indicates first reply)
|
||
map ,hi 1G}oHi!<CR><ESC>
|
||
"
|
||
" ,ha = "helloagain" (indicates reply to reply)
|
||
map ,ha 1G}oHello, again!<CR><ESC>
|
||
"
|
||
" ,H = "Hallo, Du!" (German equivalent of "hi!" for replies)
|
||
map ,H G/Quoting /e+1<CR>ye1G}oHallo, !<ESC>Po<ESC>
|
||
"
|
||
"
|
||
" Part 6 - Inserting Special or Standard Text
|
||
" Part 6b - End of text - dealing with "signatures".
|
||
"
|
||
" remove signatures
|
||
"
|
||
" ,kqs = kill quoted sig (to remove those damn sigs for replies)
|
||
" goto end-of-buffer, search-backwards for a quoted sigdashes
|
||
" line, ie "^> -- $", and delete unto end-of-paragraph:
|
||
map ,kqs G?^> -- $<CR>d}
|
||
" map ,kqs G?^> *-- $<CR>dG
|
||
" ,kqs = kill quoted sig unto start of own signature:
|
||
" map ,kqs G?^> *-- $<CR>d/^-- $/<C-M>
|
||
"
|
||
" ,aq = "add quote"
|
||
" Reads in a quote from my favourite quotations:
|
||
nmap ,aq :r!agrep -d "^-- $" ~/.P/txt/quotes.favourite<ESC>b
|
||
" see http://www.math.fu-berlin.de/~guckes/txt/quotes.favourite
|
||
"
|
||
" ,s = "sign" -
|
||
" Read in signature file (requires manual completion):
|
||
nmap ,s :r!agrep -d "^-- $" ~/.P/sig/SIGS<S-Left>
|
||
"
|
||
" available as http://www.math.fu-berlin.de/~guckes/sig/SIGS
|
||
"
|
||
" ,S = signature addition of frequently used signatures
|
||
nmap ,SE :r!agrep -d "^-- $" comp.mail.elm ~/.P/sig/SIGS<S-Left>
|
||
nmap ,SM :r!agrep -d "^-- $" WOOF ~/.P/sig/SIGS<S-Left>
|
||
nmap ,SV :r!agrep -d "^-- $" IMproved ~/.P/sig/SIGS<S-Left>
|
||
"
|
||
" ,at = "add text" -
|
||
" read in text file (requires manual completion):
|
||
nmap ,at :r ~/.P/txt/
|
||
"
|
||
" MUTT: Auto-kill signatures for replies
|
||
" map ,kqs G?^> *-- $<C-M>dG
|
||
" autocmd BufRead .followup,.letter,mutt*,nn.*,snd.* :normal ,kqs
|
||
"
|
||
" At the end of editing your reply you should check your spelling
|
||
" with the spelling checker "ispell".
|
||
" These mappings are from Lawrence Clapp lclapp@iname.com:
|
||
" spellcheck the document -- skip quoted text
|
||
" nmap <F5> :w ! grep -v '^>' \| spell<CR>
|
||
" vmap <F5> :w ! grep -v '^>' \| spell<CR>
|
||
" At home under Linux it looks something more like this:
|
||
" nmap <F5> :w ! grep -v '^>' \| ispell -???<CR>
|
||
"
|
||
" Tell the recipient that I was replying to an old email of his:
|
||
ab SvenR Sven [finally takeing the time to reply to old emails]
|
||
"
|
||
" Toggles: [todo]
|
||
"
|
||
" toggle autoindent
|
||
" toggle hlsearch
|
||
" cycle textwidth between values 60, 70, 75, 80
|
||
"
|
||
" ===================================================================
|
||
" HTML - HTML - HTML - HTML - HTML - HTML - HTML - HTML
|
||
" ===================================================================
|
||
" This has become quite big - so I moved it out to another file:
|
||
" http://www.math.fu-berlin.de/~guckes/vim/source/html.vim [980227]
|
||
source ~guckes/.P/vim/source/html.vim
|
||
"
|
||
" ===================================================================
|
||
" LaTeX - LaTeX - LaTeX - LaTeX - LaTeX - LaTeX - LaTeX
|
||
" ===================================================================
|
||
" This has become quite big - so I moved it out to another file:
|
||
" http://www.math.fu-berlin.de/~guckes/vim/source/latex.vim
|
||
" source ~guckes/.P/vim/source/latex.vim
|
||
"
|
||
" ===================================================================
|
||
" PGP - encryption and decryption
|
||
" ===================================================================
|
||
"
|
||
" encrypt
|
||
map ;e :%!/bin/sh -c 'pgp -feast 2>/dev/tty'
|
||
" decrypt
|
||
map ;d :/^-----BEG/,/^-----END/!/bin/sh -c 'pgp -f 2>/dev/tty'
|
||
" sign
|
||
map ;s :,$! /bin/sh -c 'pgp -fast +clear 2>/dev/tty'
|
||
map ;v :,/^-----END/w !pgp -m
|
||
"
|
||
" PGP - original mappings
|
||
"
|
||
" encrypt and sign (useful for mailing to someone else)
|
||
"csh: map #1 :,$! /bin/sh -c 'pgp -feast 2>/dev/tty^V|^V|sleep 4'
|
||
" sh: map #1 :,$! pgp -feast 2>/dev/tty^V|^V|sleep 4
|
||
"
|
||
" sign (useful for mailing to someone else)
|
||
"csh: map #2 :,$! /bin/sh -c 'pgp -fast +clear 2>/dev/tty'
|
||
" sh: map #2 :,$! pgp -fast +clear 2>/dev/tty
|
||
"
|
||
" decrypt
|
||
"csh: map #3 :/^-----BEG/,/^-----END/!\
|
||
" /bin/sh -c 'pgp -f 2>/dev/tty^V|^V|sleep 4'
|
||
" sh: map #3 :/^-----BEG/,/^-----END/!\
|
||
" pgp -f 2>/dev/tty^V|^V|sleep 4
|
||
"
|
||
" view (pages output, like more)
|
||
"csh: map #4 :,/^-----END/w !pgp -m
|
||
" sh: map #4 :,/^-----END/w !pgp -m
|
||
"
|
||
" encrypt alone (useful for encrypting for oneself)
|
||
"csh: map #5 :,$! /bin/sh -c 'pgp -feat 2>/dev/tty^V|^V|sleep 4'
|
||
" sh: map #5 :,$! pgp -feat 2>/dev/tty^V|^V|sleep 4
|
||
"
|
||
" Elijah http://www.mathlab.sunysb.edu/~elijah/pgppub.html says :
|
||
" The significant feature is that stderr is redirected independently
|
||
" of stdout, and it is redirected to /dev/tty which is a synonym for
|
||
" the current terminal on Unix. I don't know why the ||sleep 4
|
||
" stuff is there, but it is harmless so I left it. Since csh is such
|
||
" junk, special rules are used if you are using it (tcsh, too).
|
||
" ksh and bash should use the sh form. zsh, et al: consult your
|
||
" manual. The #<num> format is used to map function keys. If your
|
||
" terminal does not support the requested function key, use a
|
||
" literal #<num>. Not all of the clones correctly support this.
|
||
"
|
||
" ===================================================================
|
||
" Useful stuff. At least these are nice examples. :-)
|
||
" ===================================================================
|
||
"
|
||
" ,t = transpose two characters: from aXb -> bXa
|
||
" map ,t XplxhhPl
|
||
" This macros shortened by one character by
|
||
" Preben Guldberg c928400@student.dtu.dk
|
||
" map ,t XpxphXp
|
||
" map ,t xphXpxp
|
||
"
|
||
" make space move the cursor to the right - much better than a *beep*
|
||
" nmap \ l
|
||
"
|
||
" ,E = execute line
|
||
" map ,E 0/\$<CR>w"yy$:<C-R>y<C-A>r!<C-E>
|
||
" This command excutes a shell command from the current line and
|
||
" reads in its output into the buffer. It assumes that the command
|
||
" starts with the fist word after the first '$' (the shell prompt
|
||
" of /bin/sh). Try ",E" on that line, ie place the cursor on it
|
||
" and then press ",E":
|
||
" $ ls -la
|
||
" Note: The command line commands have been remapped to tcsh style!!
|
||
"
|
||
"
|
||
" ,dr = decode/encode rot13 text
|
||
vmap ,dr :!tr A-Za-z N-ZA-Mn-za-m
|
||
|
||
" Use this with an external "rot13" script:
|
||
" " ,13 - rot13 the visual text
|
||
" vmap ,13 :!rot13<CR>
|
||
"
|
||
" Give the URL under the cursor to Netscape
|
||
" map ,net yA:!netscape -remote "openurl <C-R>""
|
||
"
|
||
"
|
||
" ===================================================================
|
||
" Mapping of special keys - arrow keys and function keys.
|
||
" ===================================================================
|
||
" Buffer commands (split,move,delete) -
|
||
" this makes a little more easy to deal with buffers.
|
||
" (works for Linux PCs in room 030)
|
||
map <F4> :split<C-M>
|
||
map <F5> :bp<C-M>
|
||
map <F6> :bn<C-M>
|
||
map <F12> :bd<C-M>
|
||
"
|
||
" Buffer commands (split,move,delete) -
|
||
" for Mac keyboard (Performa 5200, US keyboard)
|
||
"
|
||
map <ESC>[19~ :split<C-M>
|
||
map <ESC>[20~ :bp<C-M>
|
||
map <ESC>[23~ :bn<C-M>
|
||
map <ESC>[31~ :bd<C-M>
|
||
"
|
||
" Obvious mappings
|
||
"
|
||
" map <PageUp> <C-B>
|
||
" map <PageDown> <C-F>
|
||
"
|
||
" Emacs style editing in insert mode
|
||
" This is something I tried for a minute
|
||
" and forgot about the minute after. ;-)
|
||
"
|
||
" imap <C-A> <ESC>0i
|
||
" imap <C-B> <ESC>hi
|
||
" imap <C-D> <ESC>xi
|
||
" imap <C-E> <ESC>A
|
||
" imap <C-F> <ESC>lli
|
||
" imap <C-N> <ESC>jli
|
||
" imap <C-P> <ESC>kli
|
||
" imap <ESC>b <ESC>bi
|
||
" imap <ESC>f <ESC>lWi
|
||
"
|
||
" Normal mode - tcsh style movements [960425]
|
||
"
|
||
" nmap <C-A> 0
|
||
" nmap <C-B> h
|
||
" nmap <C-D> x
|
||
" nmap <C-E> $
|
||
" nmap <C-F> l
|
||
" nmap <ESC>b b
|
||
" nmap <ESC>f w
|
||
"
|
||
" DOS keyboard mapping for cursor keys
|
||
"
|
||
" map <ESC>[A <Up>
|
||
" map <ESC>[B <Down>
|
||
" map <ESC>[C <Right>
|
||
" map <ESC>[D <Left>
|
||
" imap <ESC>[A <Up>
|
||
" imap <ESC>[B <Down>
|
||
" imap <ESC>[C <Right>
|
||
" imap <ESC>[D <Left>
|
||
"
|
||
" DOS keyboard
|
||
" "insert"
|
||
" map <ESC>[1~ i
|
||
" map <ESC>[1~ <insert>
|
||
" "home"
|
||
" map <ESC>[2~ ^
|
||
" map <ESC>[2~ 0
|
||
" map <ESC>[2~ <Home>
|
||
" "pgup"
|
||
" map <ESC>[3~ <C-B>
|
||
" map <ESC>[3~ <PageUp>
|
||
" "delete"
|
||
" map <ESC>[4~ x
|
||
" map <ESC>[4~ <Del>
|
||
" "end"
|
||
" map <ESC>[5~ $
|
||
" map <ESC>[5~ <END>
|
||
" "pgdn"
|
||
" map <ESC>[6~ <C-F>
|
||
" map <ESC>[6~ <PageDown>
|
||
"
|
||
" Keyboard mapping for cursor keys
|
||
" [works for SUNs in Solarium (room 030) - 970815]
|
||
"
|
||
map <ESC>OA <Up>
|
||
map <ESC>OB <Down>
|
||
map <ESC>OC <Right>
|
||
map <ESC>OD <Left>
|
||
imap <ESC>OA <Up>
|
||
imap <ESC>OB <Down>
|
||
imap <ESC>OC <Right>
|
||
imap <ESC>OD <Left>
|
||
"
|
||
" Keyboard mapping for cursor keys
|
||
" [works for XTerminals - 970818]
|
||
map <ESC>[A <Up>
|
||
map <ESC>[B <Down>
|
||
map <ESC>[C <Right>
|
||
map <ESC>[D <Left>
|
||
imap <ESC>[A <Up>
|
||
imap <ESC>[B <Down>
|
||
imap <ESC>[C <Right>
|
||
imap <ESC>[D <Left>
|
||
"
|
||
" ===================================================================
|
||
" AutoCommands
|
||
" ===================================================================
|
||
"
|
||
" Autocommands are the key to "syntax coloring".
|
||
" There's one command in your vimrc that should
|
||
" load/source the file $VIMRUNTIME/syntax/syntax.vim
|
||
" which contains the definition for colors and
|
||
" the autocommands that load other syntax files
|
||
" when necessary, ie when the filename matches
|
||
" a given pattern, eg "*.c" or *".html".
|
||
"
|
||
" just load the main syntax file when Vim was compiled with "+syntax"
|
||
if has("syntax")
|
||
" define my own syntax file (to be sourced t the end of syntax.vim):
|
||
" let mysyntaxfile="~guckes/.P/vim/syntax/syntax.vim"
|
||
" URL: http://www.math.fu-berlin.de/~guckes/vim/syntax/syntax.vim
|
||
" The main/standard syntax file:
|
||
so $VIMRUNTIME/syntax/syntax.vim
|
||
"
|
||
" Use my own syntax file on "mail/news messages":
|
||
let aucommand = "au BufRead ".MAILNEWSFILES
|
||
" exe aucommand." source ~guckes/.P/vim/syntax/sven.vim"
|
||
"
|
||
hi! Comment term=bold ctermfg=cyan guifg=Blue
|
||
endif
|
||
"
|
||
"
|
||
" EXAMPLE: Restricting mappings to some files only:
|
||
" An autocommand does the macthign on the filenames -
|
||
" but abbreviations are not expanded within autocommands.
|
||
" Workaround: Use "exe" for expansion:
|
||
" let aucommand = "au BufRead ".MAILNEWSFILES
|
||
" exe aucommand." :map ,hi 1G}oHi!<CR><ESC>"
|
||
" exe aucommand." :map ,ha 1G}oHello, again!<CR><ESC>"
|
||
" exe aucommand." :map ,H G/Quoting /e+1<CR>ye1G}oHallo, !<ESC>Po<ESC>"
|
||
" exe aucommand." :map ,re 1G}oRe!<CR><ESC>"
|
||
"
|
||
" Automatically place the cursor onto the first line of the mail body:
|
||
" autocmd BufRead MAILNEWSFILES :normal 1G}j
|
||
"
|
||
" Toggle syntax coloring on/off with "__":
|
||
" nn __ mg:if has("syntax_items")<Bar>syn clear<CR>else<Bar>syn on<CR>en<CR>`g
|
||
" Note: It works - but the screen flashes are quite annoying. :-/
|
||
"
|
||
"
|
||
" ===================================================================
|
||
" EXAMPLES
|
||
" ===================================================================
|
||
"
|
||
" Visualizing trailing whitespace:
|
||
" :set hls
|
||
" /\s\+$
|
||
"
|
||
" Toggling a numerical variable between two values.
|
||
" Example: Switch the textwidth (tw) between values "70" and "80":
|
||
" map \1 :let &tw = 150 - &tw<CR>
|
||
"
|
||
" Capitalizing the previously typed word,
|
||
" returning to the previous position:
|
||
" imap CAP <ESC>mzB~`za
|
||
"
|
||
" Uppercasing the previously typed word,
|
||
" returning to the previous position:
|
||
" imap CAP <ESC>mzvBU`za
|
||
" imap CAP <ESC>mzBvaWU`za
|
||
"
|
||
" ===================================================================
|
||
" TEMPORARY STUFF - TESTING THINGS
|
||
" ===================================================================
|
||
"
|
||
" View a html document (or part of it) with lynx. You need
|
||
" a system that supports the /def/fd/* file descriptors :-(
|
||
"nmap ,ly :w !lynx -force_html /dev/fd/0<CR>
|
||
"vmap ,ly :w !lynx -force_html /dev/fd/0<CR>
|
||
"
|
||
" Fri Jun 19 19:19:19 CEST 1998
|
||
" Hi, Vikas! vikasa@att.com
|
||
" The <Left> key produces the code "<Esc>OD" and Vikas wants to make
|
||
" Vim jump back one word in normal mode, ie using the command 'b':
|
||
" nmap <Esc>OD b
|
||
" Works for me! :-)
|
||
"
|
||
" Some simple example of the "expand modifiers":
|
||
" insert the current filename *with* path:
|
||
iab YPATHFILE <C-R>=expand("%:p")<cr>
|
||
" insert the current filename *without* path:
|
||
iab YFILE <C-R>=expand("%:t:r")<cr>
|
||
" insert the path of current file:
|
||
iab YPATH <C-R>=expand("%:h")<cr>
|
||
"
|
||
" #b = "browse" - send selected URL to Netscape
|
||
vmap #b y:!netscape -remote "openurl <C-R>""
|
||
"
|
||
" Toggle highlight search and report the current value:
|
||
" map #1 :set hls!<cr>
|
||
" map #2 :echo "HLSearch: " . strpart("OffOn",3*&hlsearch,3)<cr>
|
||
" map ## #1#2
|
||
"
|
||
" Sorting current line containing a list of numbers
|
||
" map ## :s/ /<C-M>/g<CR>vip!sort -n
|
||
"
|
||
" Replying to the mutt mailing list:
|
||
" Remove header lines Cc: and Bcc: and insert [mutt] at the beginning
|
||
" map ,MM 1G/^Cc:<CR>2dd}o[mutt]<CR>
|
||
"
|
||
" map ,U %s#<URL:\(.*\)>#<a href="\1"></a>#gc
|
||
" map ,F {jma}kmb:'a,'b!sed -e "s/^>//"<C-V><C-V>|\
|
||
" sed -f ~/.P/elm/scripts/weedout.sed
|
||
" map ,mb ebi<CR><b><ESC>Ea</b><CR><ESC>dw
|
||
"
|
||
" stripping netscape bookmarks and making them list items
|
||
" vmap ,ns :.,$s/^ *<DT><\(A.*"\) ADD.*">\(.*\)$/<li> <\1><C-M><C-I>\2/
|
||
"
|
||
" Jump to the last space before the 80th column.
|
||
" map ,\| 80\|F
|
||
"
|
||
" extracting variable names from mutt's init.c
|
||
" :%s/^.*"\([a-z0-9_]*\)".*$/\1/
|
||
"
|
||
" \<> = change to <> notation by substituting ^M and ^[
|
||
" cab \<> s/<C-V><ESC>/<ESC>/gc<C-M>:s/<C-V><C-M>/<C-M>/gc<C-M>
|
||
"
|
||
" Changing the From_ line in pseudo mail folders to an appropriate
|
||
" value - so you can read them with a mailer.
|
||
" %s/^From /From guckes Thu Apr 6 12:07:00 1967/
|
||
"
|
||
" ===================================================================
|
||
" ASCII tables - you may need them some day. Save them to a file!
|
||
" ===================================================================
|
||
"
|
||
" ASCII Table - | octal value - name/char |
|
||
"
|
||
" |000 nul|001 soh|002 stx|003 etx|004 eot|005 enq|006 ack|007 bel|
|
||
" |010 bs |011 ht |012 nl |013 vt |014 np |015 cr |016 so |017 si |
|
||
" |020 dle|021 dc1|022 dc2|023 dc3|024 dc4|025 nak|026 syn|027 etb|
|
||
" |030 can|031 em |032 sub|033 esc|034 fs |035 gs |036 rs |037 us |
|
||
" |040 sp |041 ! |042 " |043 # |044 $ |045 % |046 & |047 ' |
|
||
" |050 ( |051 ) |052 * |053 + |054 , |055 - |056 . |057 / |
|
||
" |060 0 |061 1 |062 2 |063 3 |064 4 |065 5 |066 6 |067 7 |
|
||
" |070 8 |071 9 |072 : |073 ; |074 < |075 = |076 > |077 ? |
|
||
" |100 @ |101 A |102 B |103 C |104 D |105 E |106 F |107 G |
|
||
" |110 H |111 I |112 J |113 K |114 L |115 M |116 N |117 O |
|
||
" |120 P |121 Q |122 R |123 S |124 T |125 U |126 V |127 W |
|
||
" |130 X |131 Y |132 Z |133 [ |134 \ |135 ] |136 ^ |137 _ |
|
||
" |140 ` |141 a |142 b |143 c |144 d |145 e |146 f |147 g |
|
||
" |150 h |151 i |152 j |153 k |154 l |155 m |156 n |157 o |
|
||
" |160 p |161 q |162 r |163 s |164 t |165 u |166 v |167 w |
|
||
" |170 x |171 y |172 z |173 { |174 | |175 } |176 ~ |177 del|
|
||
"
|
||
" ===================================================================
|
||
" ASCII Table - | decimal value - name/char |
|
||
"
|
||
" |000 nul|001 soh|002 stx|003 etx|004 eot|005 enq|006 ack|007 bel|
|
||
" |008 bs |009 ht |010 nl |011 vt |012 np |013 cr |014 so |015 si |
|
||
" |016 dle|017 dc1|018 dc2|019 dc3|020 dc4|021 nak|022 syn|023 etb|
|
||
" |024 can|025 em |026 sub|027 esc|028 fs |029 gs |030 rs |031 us |
|
||
" |032 sp |033 ! |034 " |035 # |036 $ |037 % |038 & |039 ' |
|
||
" |040 ( |041 ) |042 * |043 + |044 , |045 - |046 . |047 / |
|
||
" |048 0 |049 1 |050 2 |051 3 |052 4 |053 5 |054 6 |055 7 |
|
||
" |056 8 |057 9 |058 : |059 ; |060 < |061 = |062 > |063 ? |
|
||
" |064 @ |065 A |066 B |067 C |068 D |069 E |070 F |071 G |
|
||
" |072 H |073 I |074 J |075 K |076 L |077 M |078 N |079 O |
|
||
" |080 P |081 Q |082 R |083 S |084 T |085 U |086 V |087 W |
|
||
" |088 X |089 Y |090 Z |091 [ |092 \ |093 ] |094 ^ |095 _ |
|
||
" |096 ` |097 a |098 b |099 c |100 d |101 e |102 f |103 g |
|
||
" |104 h |105 i |106 j |107 k |108 l |109 m |110 n |111 o |
|
||
" |112 p |113 q |114 r |115 s |116 t |117 u |118 v |119 w |
|
||
" |120 x |121 y |122 z |123 { |124 | |125 } |126 ~ |127 del|
|
||
"
|
||
" ===================================================================
|
||
" ASCII Table - | hex value - name/char |
|
||
"
|
||
" | 00 nul| 01 soh| 02 stx| 03 etx| 04 eot| 05 enq| 06 ack| 07 bel|
|
||
" | 08 bs | 09 ht | 0a nl | 0b vt | 0c np | 0d cr | 0e so | 0f si |
|
||
" | 10 dle| 11 dc1| 12 dc2| 13 dc3| 14 dc4| 15 nak| 16 syn| 17 etb|
|
||
" | 18 can| 19 em | 1a sub| 1b esc| 1c fs | 1d gs | 1e rs | 1f us |
|
||
" | 20 sp | 21 ! | 22 " | 23 # | 24 $ | 25 % | 26 & | 27 ' |
|
||
" | 28 ( | 29 ) | 2a * | 2b + | 2c , | 2d - | 2e . | 2f / |
|
||
" | 30 0 | 31 1 | 32 2 | 33 3 | 34 4 | 35 5 | 36 6 | 37 7 |
|
||
" | 38 8 | 39 9 | 3a : | 3b ; | 3c < | 3d = | 3e > | 3f ? |
|
||
" | 40 @ | 41 A | 42 B | 43 C | 44 D | 45 E | 46 F | 47 G |
|
||
" | 48 H | 49 I | 4a J | 4b K | 4c L | 4d M | 4e N | 4f O |
|
||
" | 50 P | 51 Q | 52 R | 53 S | 54 T | 55 U | 56 V | 57 W |
|
||
" | 58 X | 59 Y | 5a Z | 5b [ | 5c \ | 5d ] | 5e ^ | 5f _ |
|
||
" | 60 ` | 61 a | 62 b | 63 c | 64 d | 65 e | 66 f | 67 g |
|
||
" | 68 h | 69 i | 6a j | 6b k | 6c l | 6d m | 6e n | 6f o |
|
||
" | 70 p | 71 q | 72 r | 73 s | 74 t | 75 u | 76 v | 77 w |
|
||
" | 78 x | 79 y | 7a z | 7b { | 7c | | 7d } | 7e ~ | 7f del|
|
||
" ===================================================================
|
||
"
|
||
" ===================================================================
|
||
" If your read this...
|
||
" ===================================================================
|
||
" ... then please send me an email! Thanks! --Sven guckes@vim.org
|
||
" I have received some emails so far - thanks, folks!
|
||
" Enjoy Vim! :-)
|
||
" ===================================================================
|
||
" Yet another example for an autocommand: [980616]
|
||
au VimLeave * echo "Thanks for using Vim"version". --Sven Guckes@vim.org!"
|
||
" ===================================================================
|
||
" Last but not least...
|
||
" =====================================================
|
||
" The last line is allowed to be a "modeline" with my setup.
|
||
" It gives vim commands for setting variable values that are
|
||
" specific for editing this file. Used mostly for setting
|
||
" the textwidth (tw) and the "shiftwidth" (sw).
|
||
" Note that the colon within the value of "comments" needs to
|
||
" be escaped with a backslash! (Thanks, Thomas!)
|
||
" vim:tw=70 et sw=4 comments=\:\"
|